KEGG   Pedobacter heparinus: Phep_1388Help
Entry
Phep_1388         CDS       T00978                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
phe  Pedobacter heparinus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Phep_1388
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Phep_1388
Enzymes [BR:phe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Phep_1388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1652310..1655027
Genome map
AA seq 905 aa AA seqDB search
MKTRVYLVLLLLACLYSKAQDKTSTIIPAPVKITVSKGIYHLTQSTPVTFSGFKQVPAGL
KEFATKTLWFKAAATNVKHSSNKGLMVVLDKTIQLPDEGYRLSVNASGIKIVSDTEKGLF
YGLQTLLQLIPDEGSALSFTEIEDYPRYSYRGLHLDVGRHLFPVSFIKQYIDLLAQYKLN
TFHWHLTEDQGWRIEIKKYPKLTTVGGFREQTLIGKLRTKPEVYDSIRYGGFYTQKEVRE
IVAYAASKYVVVIPEIEMPGHSLAALSAYPQFACGDDPGPFKAAQTWGIFPDVYCAGKEE
TFKFLEDILDEVMSLFPAKYIHIGGDECPKDRWKTCRYCQKRIRDLGLKDEHELQSYFIQ
RMEKYVNSKGKKIIGWDEILEGGLAKNAVVMSWRGTKGGIAAAQQDHDVIMTPGAFLYFN
YTENKADEGPLTHGSFLPLSKVYSYNPTPENLSPLQQKRIIGVQANLWSEYIATPDKALY
MLLPRLFALSEVAWTMPQNKSWINFSEKKLTVHLAKLDKTGTMFHVPSPIGAKDTTITAA
TYLLDYKVPVKGAKIYYTINGYFPYQTDYLYKGPVIINVPPSQERIIKSVVITPSGKRSS
TVTVHVVNQQNVKQSSSAPKRLRIGYSIPIDKITPESMAYAKANGIACIETFLGPYVDTA
RNFKFTDEQITAKIKAAKKAADDAGIEIWSVHMLFGKRIDISLPDEAERQKVMELHKKIL
GFCSILKPKLILFHPSWYLGLNERELRKSQMIKSAVEMNKVVKAINATLVIENMLGPELL
VDARRERPLCRTVEETVEIMNRLPADIYSAIDLNHIKNPERLIDAMGERVKTLHVADGTG
RAENHFFPCSGQGQNDWVAIFTALAKVNYNGPFMYESAYKDAKDFKSCYETLYQSFERSL
QVKKE
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaagagtatacttagttttattgcttttagcctgtctttacagtaaagcgcag
gacaagacatcaactattattccagccccggttaaaattacagtcagtaagggtatttat
cacttaacccaaagtacgccggtaacatttagtggctttaaacaagtgccggcgggatta
aaggaatttgccactaaaaccctgtggtttaaggctgcagctacaaacgttaaacatagt
tcaaataaaggacttatggttgtcctggataaaactattcagctgccggatgaaggctac
cggttgtctgtaaatgccagtggtatcaaaatagtatctgataccgaaaagggtttgttt
tatggcttgcaaaccttattgcagctcatccccgatgagggaagcgccctatctttcacc
gaaatagaagattacccgcgttacagttaccggggcctgcacctggatgtaggcaggcat
ttatttccggtcagttttatcaaacaatatattgatttactggcccagtataaactaaac
acttttcactggcatttaacagaggatcagggctggcggatagaaattaaaaaatatcca
aaactaaccactgttgggggatttcgtgagcaaaccctgattggtaaattaaggacgaaa
cccgaagtatatgacagcatccgttacggtggtttttatactcaaaaagaggtacgtgag
atagttgcttatgcggcgtcaaagtatgttgtcgtgattcctgaaattgaaatgcccggg
cattccctggcagcattgtctgcctatcctcaatttgcttgtggtgatgacccgggacct
ttcaaggctgctcagacatggggaatatttcctgatgtttactgcgcaggcaaggaagaa
acatttaagttcctggaagatatattggacgaggtgatgtcacttttcccggcaaaatac
atacatattggcggtgatgaatgccctaaagaccgatggaaaacctgcaggtattgtcaa
aaaaggattagggacttgggtttaaaagacgagcatgagttgcaatcatactttattcaa
cggatggaaaaatatgtgaacagcaaaggtaagaagattataggctgggatgagatattg
gaaggtggattggcaaaaaatgctgtagtaatgagctggcgcggtaccaaaggtggtatt
gctgctgcacagcaggaccatgatgtgatcatgacccccggtgcttttttatatttcaat
tatacggagaacaaagccgatgagggtccgttaactcatggttcttttttacccttaagt
aaagtttattcctacaatccaacgcctgaaaatctaagtccattgcagcaaaaacgcatt
ataggtgtgcaggctaacctgtggtcggaatatatagcaacgccagacaaggcactatac
atgctgctgccaagactttttgccttgtctgaagtcgcatggaccatgccacagaacaaa
agctggattaatttctccgagaagaaattaactgtccatctggcaaagctggataaaact
ggcactatgtttcatgtacccagccccataggagcgaaggatacaacaataacggctgct
acttatctgctggattataaagtcccggtaaagggcgcaaaaatttactatacgattaat
ggttattttccataccaaacagattatttatataaggggcctgtaattataaatgtacca
ccaagtcaggaaagaattatcaagtcggtcgtaattacaccttcgggtaaacgcagcagc
acggttacagtgcatgttgtgaatcagcaaaacgttaagcaaagttcatctgcaccaaaa
cgtttacgtataggatattctatccccattgataaaattaccccggaaagtatggcttat
gccaaggctaacggaatagcttgtattgaaacctttttggggccatatgtcgataccgcc
agaaattttaagtttacagatgagcagataaccgcaaaaattaaggcagcaaaaaaggca
gcagatgatgcggggatagaaatatggtcggtgcatatgttatttggtaaacgaatagac
atttcgctgccggatgaggctgaacgtcaaaaagtgatggaattgcacaaaaaaatactt
ggtttttgcagtatccttaaacccaaactcatcctgtttcatccaagctggtatcttggc
cttaacgaacgcgagttgcgtaaaagtcagatgattaaatcggcagtcgaaatgaataag
gtagtgaaagccataaatgccactttggtaatagagaatatgctgggtcctgaattactg
gtagatgcaaggcgggaacgaccgttatgccgcactgtagaggaaactgtagagatcatg
aacagattgcctgcggatatctattcggctatagaccttaaccatattaaaaatcctgag
cggttgatagatgccatgggtgaacgtgtaaagacgctacatgttgcagatggaacaggc
agggcggaaaaccattttttcccatgtagtgggcaagggcaaaacgattgggtagccata
tttacagcacttgctaaagtaaactataatggcccctttatgtatgagtctgcttataaa
gatgcgaaagattttaagtcctgctatgaaacgctgtatcaatcctttgagcggtcactt
caggttaagaaagagtga

DBGET integrated database retrieval system