KEGG   Pedobacter heparinus: Phep_1551Help
Entry
Phep_1551         CDS       T00978                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
phe  Pedobacter heparinus
Brite
Enzymes [BR:phe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Phep_1551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1837435..1838091
Genome map
AA seq 218 aa AA seqDB search
MAYKFVDNYREQGARKRLVAHLEARGIADKKVLKAIGKVPRHFFFDETFWNQAYKDIAFP
IGDGQTISQPYTVAYQSELLHIKKGDKVLEIGTGSGYQTCILMELGANVYTIERQESIYR
HTIRVLPGMGYNAHFFFGDGSKGIAAHAPYDKIIVTAGAPFVPEILLKQLRIGGILVIPV
GDEHSQKMVTVIRVNETDFERIELDTFRFVPLVGDQAW
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcatataagtttgttgacaattacagagagcagggggcgagaaaaagattggtggcg
catttggaagcgaggggcattgcagataaaaaagtgcttaaagcaataggcaaggtgccc
cggcatttctttttcgacgaaaccttttggaaccaggcgtacaaggatattgctttcccg
attggtgatggacagaccatctcacagccatataccgtcgcttaccaaagcgaactgctg
cacataaaaaaaggtgataaagttctggaaattggaacaggctcgggctaccagacctgt
atattaatggaacttggtgccaacgtatataccatagaacgacaggaaagcatataccgg
cacaccatcagggtactgcctggcatgggatacaatgcgcatttcttttttggcgatggt
tctaaaggtattgcagcgcatgcaccttatgataagatcatagtaacagctggggcacct
tttgtacctgaaattttgctaaaacagcttaggataggcggtatactggtaattccggta
ggggatgaacattcgcaaaaaatggtaacggtaatcagggtaaacgaaacagatttcgaa
aggatagaactcgataccttcaggtttgtaccattggtaggcgatcaggcctggtaa

DBGET integrated database retrieval system