KEGG   Pedobacter heparinus: Phep_1568Help
Entry
Phep_1568         CDS       T00978                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
phe  Pedobacter heparinus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Phep_1568
   01230 Biosynthesis of amino acids
    Phep_1568
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Phep_1568
   00051 Fructose and mannose metabolism
    Phep_1568
   00562 Inositol phosphate metabolism
    Phep_1568
Enzymes [BR:phe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Phep_1568
Exosome [BR:phe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Phep_1568
  Exosomal proteins of bladder cancer cells
   Phep_1568
  Exosomal proteins of melanoma cells
   Phep_1568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1851826..1852590
Genome map
AA seq 254 aa AA seqDB search
MMRKKIVAGNWKMNLDYAAGISLFSEIVNMVKDEKKGNQIAIICAPYIHLNSLAKLGADV
VKIGAQNCHQNDSGAYTGEISAGMIKSVGVEYVIIGHSERREYFAESDELLAQKTIKVLE
NGLTPIFCIGETLEQRNNGSYFEVLKAQLDKGIFGLSAEDFSKIVIAYEPVWAIGTGLTA
SSDQAQEVHAFIRKEIAAKYNAQVAELTTILYGGSCNPKNAAELFAQKDIDGGLIGGASL
KSRDFVDIVKVFNS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaaaaaaaatagttgcaggaaattggaaaatgaaccttgattatgctgccggc
atatctttattttcagaaatagtgaatatggtaaaggacgaaaaaaaaggtaatcagatc
gccatcatttgtgctccctatattcatttgaacagcctggctaaattgggtgctgatgtt
gttaaaattggggcgcaaaactgtcaccaaaacgatagtggtgcctatactggcgaaatt
tccgccggaatgatcaaatctgtaggtgttgaatatgtaatcatcgggcactcagaaaga
cgcgagtactttgccgaaagtgatgaactgctggcacagaaaacaataaaagtattggaa
aacggattgacacctattttttgtatcggagaaaccttggagcaaagaaacaatggcagt
tatttcgaggtacttaaagcccaactcgataaaggtatttttggattaagtgccgaagat
ttttctaaaatagtgattgcttatgaaccggtttgggcaataggaacgggattaaccgca
tcctcagatcaggcccaggaagtacatgccttcatcagaaaagaaattgcagccaaatac
aatgcccaggttgcagaactgaccactatattatatggtggcagctgtaatcctaaaaac
gcggccgagctatttgcccagaaagacattgatggtggtttgataggcggagcttcacta
aaatcaagagattttgtggatatcgttaaagttttcaattcttag

DBGET integrated database retrieval system