KEGG   Pedobacter heparinus: Phep_1599Help
Entry
Phep_1599         CDS       T00978                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
phe  Pedobacter heparinus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Phep_1599
Enzymes [BR:phe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Phep_1599
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Phep_1599
Lipid biosynthesis proteins [BR:phe01004]
 Fatty acid synthase
  Component type
   Phep_1599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1894934..1895602
Genome map
AA seq 222 aa AA seqDB search
MSAIILLSMITACGNNQHTAGGQENVKTDGTVQAGTGRPETQHILFFGTSLTAGYGLDPE
EAYPAIIQKKIDSLNLPYKVINAGLSGETSAAGKSRIDWLLKQPVDIFVLELGANDGLRG
LSVAETSANLQAVIDKVKARYPKVKMVMAGMQMPPNMGASYTADFKALFSKLAQKNNMAY
IPFLLEGVGGQARLNQEDGIHPTAEGQKILAENVWARLKPLL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctatcattttgctgagcatgataactgcctgtgggaacaatcagcatacagcc
ggaggacaggaaaatgtcaaaactgatggcacagtgcaggctggtacaggccggcctgag
acacagcatatccttttttttggtacaagtttaacggcaggctacgggcttgatccggaa
gaggcgtatccggccatcatccaaaaaaagatagactcgttaaatttaccttataaagtg
atcaatgcaggcctgagcggcgaaacatcagccgcaggcaaaagcaggatagactggctg
ttaaagcagccggttgatatttttgtattggaactgggtgcaaatgatggcctgcggggc
ttatctgttgcagaaacatcggccaatctgcaggctgtaattgataaggtaaaggccagg
taccctaaggtaaaaatggtgatggccggtatgcagatgccgcccaatatgggggccagc
tatactgctgattttaaagcattgtttagcaagctggcacaaaagaacaatatggcgtat
attccttttttgctggaaggagtgggtggccaggcccggcttaaccaggaagatgggatc
catccgacggccgaagggcagaaaatactggcagaaaatgtatgggccagattaaaacct
ttactttaa

DBGET integrated database retrieval system