KEGG   Pedobacter heparinus: Phep_1706Help
Entry
Phep_1706         CDS       T00978                                 

Definition
glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
phe  Pedobacter heparinus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Phep_1706
  Lipid metabolism
   00561 Glycerolipid metabolism
    Phep_1706
   00600 Sphingolipid metabolism
    Phep_1706
Enzymes [BR:phe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Phep_1706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2021730..2023913
Genome map
AA seq 727 aa AA seqDB search
MDIRLHINKYISCFLLLFTMGLNAIAQQDKQIIVETKHTSLIFTISSGQKLYQSYLGQKL
INHSDEGLLKSTRREAYIGAGMGDLFEPAIRMVHNDGNPSLDLKYVAHKTDKQNDNVATT
SIILKDPQYPVQVVLHFTAYFNEDIIKEWTEIKHNEKKPVTLTNYASSMLHFDASKYWLS
QFDGDYMTEMRMKESQLTTGIKILDSKLGTRAQMYRSPCFYLSLNKPADENNGELIAGTL
AWSGNFQCAFEIDQQNSLRMITGMNPYASEYKLQPGKTFETPAFIFTYTKKGKGEASRNL
HRWARNYGVLDGNKPRLTLLNNWEATHMDFNQDVLVELFDGANKLGVDLFLLDDGWFGNK
YPRDADKTALGDWQVDKKKLPSGIGYLVTEAGKKNLQFGIWLEPEMVSPKSELYEKHPDW
ILKLPNREEAYSRNQLVLDLINPKVQDFIYDMVSDLLTKNPGIAFIKWDCNRMLTNTYSP
ALKENQGNLFIDYNRALYTILERLRKKHPHLPIMLCAGGGGRVDYGGLKYFTEFWPSDNT
DGLERVFIQWGYLNFFPALTVSSHVTSMGKQSLKFRTDVAMMGKMGYDIRVKNLTEQEIK
FSNQAVKTYKKISDVIWFGDLYRLISPYEENRAVLMYVDEPKNKAVLFNYLLNFRRKEYM
GKVLLNGLDPLKRYQIKEVNLLPDTKSTFPDDGKVFSGDYLMNIGLNLSSGKISPLSSSV
FEIVAQN
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggatatccgtttacatataaataaatatatctcttgttttttgttgctttttacaatg
ggtttgaatgccattgcacagcaggacaaacaaatcattgttgaaacaaaacatacatcg
ctcatttttaccatctcatccggacaaaagctttatcaaagttatcttggacaaaaactg
atcaatcacagcgatgagggcctcttaaaatcaacccgtcgtgaagcttatatcggtgct
ggtatgggtgacttatttgagcctgcaatccgtatggtacacaacgatggcaatccctcg
ctggatttaaagtatgttgcacataaaactgacaaacagaatgataatgtagctactaca
tccataatacttaaagatccacaatatccggtacaggtagtactccattttaccgcatat
tttaatgaagatattatcaaggaatggacagaaataaaacacaacgagaaaaagccggtc
actttaaccaattatgcttcttctatgttgcattttgatgcgtctaaatattggttaagc
cagtttgacggggattatatgacagaaatgaggatgaaggaaagccagttgactacaggt
ataaaaatactggatagtaaactggggacacgtgcgcaaatgtatcgttcgccttgcttc
tacctttctttaaataaacctgctgatgagaacaatggtgaactgattgcgggcacgttg
gcctggtctggtaattttcaatgtgcatttgaaattgatcagcaaaatagtctgcggatg
attaccggaatgaacccttatgcttccgaatataaattgcagccgggtaaaacttttgaa
acccctgcttttatatttacctataccaaaaaggggaaaggcgaagccagcagaaacctg
caccgctgggccaggaattatggcgtactggatggcaataaaccgcggctaacactttta
aacaattgggaagctacacacatggattttaaccaggatgtactggttgagctctttgac
ggtgcaaataaactgggggtggatctctttttactggatgacggctggtttggtaacaaa
tatccccgtgatgcggataaaacggcattgggcgactggcaggtagacaagaaaaaactg
ccaagcggaattggctacctggttactgaagctggtaaaaaaaacctgcagtttgggata
tggctggagcctgaaatggtgagcccgaaaagcgaattgtatgaaaagcatccggattgg
atattgaaattgccaaacagagaagaggcttactcacgcaaccagctggtactggatttg
atcaatccaaaagtacaggactttatatacgatatggtgagtgatctgctgactaaaaac
ccgggtattgcctttattaaatgggattgtaaccgtatgctgaccaatacgtattcgcct
gctttaaaagagaatcagggtaaccttttcatagattacaatcgggccttatatactatt
ttggagcgtttaagaaaaaaacatccgcatttgcctatcatgctatgtgccggtggaggt
ggtcgggtcgactatggcggactgaaatattttacagagttttggccaagcgacaatacc
gatggcctggagcgggtatttatacaatggggttacctcaactttttcccggccttaact
gtctccagccacgtaacttctatgggtaaacagtcgttaaagttccgtacagacgtggcc
atgatgggtaaaatgggttatgatatcagggttaaaaatctgacagaacaggaaattaaa
ttcagtaaccaggcggttaaaacttataaaaagatcagtgatgtcatctggtttggtgat
ctgtaccgtttaatctctccgtatgaggagaacagggcagttttaatgtatgtggatgag
cctaaaaacaaagccgtacttttcaattacctgcttaatttcaggcgtaaagaatatatg
gggaaggtgcttttaaacggccttgatccattaaagcgttatcagattaaggaagttaat
ttattgccggatacgaaatcgacctttccagatgatggaaaagtatttagcggcgactac
ctgatgaatattggattaaacctctcatctggtaaaatcagtcccctaagtagttctgtt
tttgaaattgttgcccaaaactaa

DBGET integrated database retrieval system