KEGG   Pedobacter heparinus: Phep_1739Help
Entry
Phep_1739         CDS       T00978                                 

Definition
DNA-formamidopyrimidine glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
phe  Pedobacter heparinus
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:phe00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Phep_1739
Enzymes [BR:phe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Phep_1739
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Phep_1739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2052072..2052848
Genome map
AA seq 258 aa AA seqDB search
MPELPDLEVFAANLEKRFKHKTLERLEVQVAKKLNVPEKELKETLEGHQLTAVKREGKTI
QLHFGPERILGLHLMLHGALNLIEADEKIKYPIVSFHFKTGHGFALTDFQKAATLTLNPV
VSDVPDALSKEMSVNYLEAVLAKKKAPIKTVLMDQHLIRGIGNTYADEILWEAGISPFSV
SKAIPKAKVRELHQVIGKLLRKEIQQISKMLPDELGGEIKDFLKIHGAGIKESPTGKKIL
VEEIGGRKSYYTEEQELY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattacctgatcttgaagtcttcgctgctaacctggaaaaacggtttaaacat
aaaaccttggagcgcctggaagtgcaggtagctaaaaagctgaatgtgccggaaaaggag
ctaaaagaaaccctggaggggcatcagctgactgctgtaaaacgcgaaggaaaaaccatc
caattgcattttggtcctgaaaggatattgggcttacacctgatgctgcatggagcgtta
aatctgattgaagctgatgagaaaataaaatatcccattgtctcatttcattttaagact
ggtcatggtttcgctttaactgattttcaaaaggctgcgaccctgacattaaatcctgtg
gtgtctgatgtaccggacgcgctttccaaagaaatgagcgtgaactatctggaagcggtt
ttggcgaaaaagaaggcgcctataaaaacggtattgatggatcagcaccttatccggggt
atcggtaatacttatgcggatgaaattttatgggaggcaggaatttcaccattctcagtt
tctaaagccattcctaaagcaaaagtaagggaactgcaccaggtgatcggaaagttattg
cgtaaggaaattcagcagatcagtaaaatgctgccagatgagctgggtggagagattaag
gattttctgaaaatccacggcgcaggtatcaaagaaagcccgaccggtaaaaagatactg
gtagaagagattggtgggcgtaaatcttattatacagaggagcaggaattgtactag

DBGET integrated database retrieval system