KEGG   Pedobacter heparinus: Phep_1872Help
Entry
Phep_1872         CDS       T00978                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
phe  Pedobacter heparinus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Phep_1872
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Phep_1872
  Amino acid metabolism
   00310 Lysine degradation
    Phep_1872
Enzymes [BR:phe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Phep_1872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2163736..2165058
Genome map
AA seq 440 aa AA seqDB search
MAQYELLLPKMGESVAEATIIKWVKQPGELIEMDDTVLEIATDKVDSEVPSPIAGRLVKQ
LFKEDDIVQVGAVIAIIETDADAPVVAEQAVETPAAVSVPEAEPVTANIPGMEQLPADFV
SDRFYSPLVKNIALQEGITVEELDTISGTGAEGRLTKDDLLNYIQNGKKTGDVSREEEVK
PVAQQSAVAQPLKVQPTQAAASISGGDEIIEMDRMRKLIAEHMVMSKQTSPHVTSFVEAD
VTNMVLWREKVKRDFEKRENEKITFTPIFVEAVSRAIKDFPMINVSVNGNQIIKKKDINI
GMAAALPSGNLIVPVIKNADELNLLGLTKAVNDLASRARASKLKPDETQNGTFTLTNVGS
FGNVMGTPIINQPQVAILAVGAIKKKPAVLETEAGDVIAIRHIMFLSLSYDHRVVDGALG
GSFVRRVADYLEKWDLNREI
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatacgaattattgttacctaaaatgggggagagcgttgcggaagcaaccata
attaaatgggttaaacaaccgggtgaactgattgagatggatgacactgttttggagatt
gccacggataaagtagattctgaagtcccatcgccaatagcgggtagattagtaaagcaa
ttatttaaagaagacgatattgtacaggtaggtgccgtaattgcgattatagaaacggat
gccgatgccccggtagttgctgagcaggcagttgaaactcctgcagcagtaagcgtacct
gaggcggagccagttacagcaaacataccggggatggaacagcttcctgctgattttgtc
tcagaccgtttttattcgcccctggtaaaaaatattgcattacaggagggaataactgtt
gaagaattggatacaattagcggaaccggtgctgaagggcgtttaactaaagatgattta
ttgaactatattcaaaacgggaaaaaaactggcgatgtaagcagagaggaagaagtgaag
cccgtagcccagcagtctgcagtcgcacaacccctaaaagttcagccaactcaggcagcg
gcaagtataagtggtggtgatgagatcattgagatggacaggatgcgtaagttaattgcc
gaacacatggtaatgagcaaacagacctctccgcatgtaacctcttttgtagaagcagat
gtaaccaatatggtactatggcgtgaaaaggtaaaaagggattttgagaagcgtgaaaac
gagaagatcacctttacgcccatatttgtggaagcggtaagcagggcgatcaaagatttt
ccgatgatcaatgtatcggtaaacggaaatcagatcattaagaaaaaagatatcaatatc
ggtatggcagctgcattaccaagtggtaacctgattgtgccggtaataaaaaatgcggat
gagctgaacctgctgggtttaacaaaagcggttaacgacctggccagccgtgcccgggcc
tcgaaattaaagcctgatgaaacgcaaaacggcactttcaccttaaccaatgtgggttct
tttggtaatgtaatgggcacaccgatcattaatcagccgcaggtagctatattggctgtg
ggtgccattaaaaagaaaccagcggtgttggaaacggaagctggtgatgtgattgcgatc
aggcatatcatgttcctttctttatcttatgaccacagggttgttgacggggcccttggg
ggttcattcgtacgccgggtggccgattacctggaaaaatgggaccttaacagagaaata
tag

DBGET integrated database retrieval system