KEGG   Pedobacter heparinus: Phep_2379Help
Entry
Phep_2379         CDS       T00978                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
phe  Pedobacter heparinus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2777205..2778983)
Genome map
AA seq 592 aa AA seqDB search
MRSISKIVILGFSATVVVTLLSLRQPDGPAVQVKQQLIRQADSLLLAVNLLRSVKMDVAQ
SQLLQQRFREVRLAYKQLEWATEYFDPLTARQVNGPPVPETELNGLVIQPDGLQLIEQYL
FPGFVSDKQQEFSGLLGRLAINATEFREFFRRADLQDWQIHDAVKQEVFRIEILGLNDFD
DPLSKRCFAESAAALQSLKGVIAHYKAVPEFDPAIGYLQHPETFDRFDRAAFIIRYANPL
TRSLKLLKDQLKLPDVRYNRLLNQDAATLFEADAFNRNAYTAEPGDSVTAEKTVLGKKLF
FDPVLSGSGKRSCASCHQPNLDFTDGLIKNLDITGKRMIMRNTPTLINAALQPAQFYDLR
VPSLEDQARDVLNNPDEMHGDMQVAIGKLWADTNYRKLFSSAYPRQGRMAIDTFEVMNAL
AGYVRSLTALNSRFDAYMQGDERAMKETALAGFNLFMGKARCGTCHFLPLFNGTLPPRYM
QMEAEVIGVPQKIDRKYIDPDLGLYRIQSGDFNRHAFKITTVRNTTRTAPYMHNGVFRTL
EEVIDFYDKGGGRGAGIEIANQTLDETPLHLNEEEKTEIIDFIKSLDSISTL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcaatttctaaaattgttatccttggtttttcagcaactgtagttgtaacgcta
ctatcccttcggcaaccggacgggccagcagtacaggttaaacaacaattaattcgtcag
gcagacagtttattgcttgctgtcaacttgttgcggtcagtaaaaatggatgttgcacaa
agccaattgttacagcagcgtttccgcgaggtaaggcttgcctataaacagctagaatgg
gccacggaatactttgatccgctaacggcccggcaagtgaacggcccgccggtaccagaa
accgaactgaatggactggtaatacagcccgatggattacaacttattgaacagtatctt
tttccgggatttgtatctgataaacaacaagaatttagtggcttactggggcgtttggca
atcaatgcaacggagttccgtgagttttttaggagagcagacctgcaggactggcagatc
catgatgcggtaaagcaggaggtttttcgaatagagatacttggacttaatgactttgat
gacccgctatccaaaaggtgttttgccgaatcggcggcagcactgcaaagtctgaagggt
gttattgctcactataaggctgtgcctgaatttgatccggctatcggttatcttcagcat
cccgaaacatttgaccgctttgatcgagccgcctttatcatccgttacgccaacccgctc
accaggtcgctcaagttattaaaggatcaattaaaattgccggatgttcgctacaaccgc
ttgcttaatcaggatgccgcaacactatttgaagcagatgcctttaaccgtaatgcttat
actgccgaaccgggggattctgttaccgcagaaaagactgttttaggcaaaaagctattc
ttcgatccggtactttctggcagtggcaagcgcagctgtgcttcctgccatcagcctaac
cttgattttacggatggcctgatcaaaaaccttgatattaccggcaaaaggatgattatg
cgcaataccccgacactgatcaatgcggctttacaacctgcacaattttatgacctgcgg
gttccttcgctggaagaccaggccagggatgtgttaaataacccagacgaaatgcatggt
gacatgcaggtagcaattggtaagctctgggccgatacgaactaccgaaagctgttcagt
agtgcttatccccgacaggggcgtatggcgattgatacctttgaggtaatgaatgccctg
gcgggatacgtgcgtagcctgactgcactgaacagtcgttttgacgcttatatgcagggc
gatgagcgtgccatgaaagagacagcgttggctggttttaacctgtttatgggcaaagcc
cgctgtggaacctgccattttctgccgctgtttaacggtacgctgccaccacgttatatg
caaatggaagcggaagtgattggggtgccccaaaaaatagatcgtaaatatatcgatccg
gatttgggcctctaccgcattcaatccggagattttaatcgccatgcctttaaaattacc
acggttcgcaataccacccgtactgcaccatatatgcacaatggtgtatttcggacactt
gaagaagtgatcgatttttatgataagggtggtggtaggggtgcgggcattgaaattgcc
aaccagacactggatgagacaccgctgcacctgaacgaagaagagaaaaccgaaataatc
gattttatcaagagcctggatagcattagcactttatag

DBGET integrated database retrieval system