KEGG   Pedobacter heparinus: Phep_2418Help
Entry
Phep_2418         CDS       T00978                                 

Definition
aldehyde dehydrogenase
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
phe  Pedobacter heparinus
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Phep_2418
   00040 Pentose and glucuronate interconversions
    Phep_2418
   00053 Ascorbate and aldarate metabolism
    Phep_2418
   00620 Pyruvate metabolism
    Phep_2418
  Lipid metabolism
   00071 Fatty acid degradation
    Phep_2418
   00561 Glycerolipid metabolism
    Phep_2418
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Phep_2418
   00310 Lysine degradation
    Phep_2418
   00330 Arginine and proline metabolism
    Phep_2418
   00340 Histidine metabolism
    Phep_2418
   00380 Tryptophan metabolism
    Phep_2418
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Phep_2418
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Phep_2418
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Phep_2418
Enzymes [BR:phe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Phep_2418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2813836..2815365)
Genome map
AA seq 509 aa AA seqDB search
MNINEILNKLGIEPDNSGTSTGSKWLASKGAVISSSSPVNGQVIASLQSTDAAGYEKVME
QASQAFLHWRKVPAPKRGEMVRQFGDALREHKDALGALVSFEMGKSLQEGMGEVQEMIDI
CDFAVGLSRQLYGLTMHSERPGHRMYEQWHPLGVVGIISAFNFPVAVWAWNTALAWVCGN
VCVWKPSSKTPLCAIACQHIVAKVLKANDLPEGISNLVTGNACGTLINEDKRIPLISFTG
STRVGKVVSATVAGRFGRSILELGGNNAIVISASADLEMSVIGAVFGAVGTAGQRCTSTR
RLIIHESVYDDFTAKLAKAYGQIKIGDPLDENNHMGPLIDQGAVEDYLNAIEQVKQQGGR
FLVEGGVVNGPGFESGCYVKPCIAEVKNHYAIVQEETFAPVLYVMKYKDIAEAIAMQNDV
PQGLSSAIMTLNLREAEQFLSAAGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSD
AWKGYMRRQTNTINYSNTLPLAQGIKFDL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaacgaaatattaaacaaactggggattgaaccagacaattcagggacttca
acaggtagtaaatggctggcatccaaaggggctgttatcagttccagctctccggtaaac
ggacaggtaattgccagcttgcaaagcacagatgcggcgggctatgaaaaagtaatggaa
caggcaagccaggcctttttgcattggagaaaggtacccgcgcctaagcgtggtgaaatg
gtacgtcagtttggagatgccctgcgtgaacataaggatgccctgggggcattggtatcc
tttgagatgggaaagagtttacaggaaggcatgggcgaggtgcaggagatgatcgacatc
tgcgattttgctgtaggattatcgaggcagctttatggcttaacgatgcattcagagagg
cccggtcaccgtatgtatgagcaatggcatccactgggggtagtcggcattatttcggcc
tttaattttcctgtggcggtttgggcctggaacactgcgctggcctgggtatgtggcaat
gtatgtgtctggaaaccttcttcaaaaacaccgctctgcgccatagcctgtcagcatatt
gttgctaaagtgttaaaggcaaatgatttacctgaaggaataagcaatttggttacgggt
aatgcctgtggtacattgatcaatgaggacaagcgtattccattgatctctttcaccggt
tctaccagagttggaaaagtggtttcagctacggtggccggcaggtttggccggagcata
ctggagctgggcggaaacaatgctattgttatttctgcaagtgcagatttagaaatgtcg
gtcatcggagctgtatttggtgcggttgggactgccgggcaacgttgtacctctacccgc
aggctgatcatccacgaaagcgtttatgatgattttacggctaaactggccaaagcttac
gggcagatcaaaattggtgatcctttggatgaaaataaccatatgggcccgctgatagac
cagggggctgtggaagattacctgaatgcgattgagcaggtgaaacaacaggggggcagg
tttttagttgaaggcggagtggttaatggaccgggttttgaatcgggctgttatgttaaa
ccttgtattgccgaggttaaaaaccactatgcaattgtacaggaagagacctttgcacct
gttctgtatgtgatgaaatacaaagacatagcggaagccatagccatgcagaatgatgta
ccccagggcctttcatctgcaattatgactttgaacctgcgtgaagcagaacagttttta
tctgccgcaggctctgactgcggtattgcaaatgtaaatattggtacctccggggctgaa
ataggcggcgcctttggtggcgagaaggagaccggtggtggcagggaaagcggatctgac
gcctggaaagggtatatgcggcggcaaacgaacaccatcaattattccaatacactgcca
ttggcccagggcataaagtttgatttgtaa

DBGET integrated database retrieval system