KEGG   Pedobacter heparinus: Phep_2680Help
Entry
Phep_2680         CDS       T00978                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
phe  Pedobacter heparinus
Brite
Enzymes [BR:phe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Phep_2680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3139673..3141457
Genome map
AA seq 594 aa AA seqDB search
MTGIKQTIAFVFILTTTTLLSIFCTQKQPAAELVKTRFNKELTLLQTIVNKDLFTAVQQK
NKKKIKKAFIAARAQYKKIEYYVAYFFPSTSEMINGAPIDEIELGENLIEKPTGFQVMEE
LIYETPTTENRDELLNQVRKMQLNLKRMDRYNQQYEITDAQIFDAIRLEIFRITSLGITG
FDSPAALQSLPEAAAALIGITNALNTYGANDDLDKALKTAIAQLSTAKDFNDFNRLDFIT
LHLQPISIKADQLRQELKINTAASGSALQDDAVSMFQKNAFNLNKFVGNYTEYITKDKTT
LGKLLFNSNILSRAGNRSCASCHHEAKAFTDGLVTAKGLKGTLLRNTPTLIYAGLQRGFF
YDLKAGSLEDQALDVVHHKNEMDGSLTAAAKKINQDKMYATSFAKAFNDKTGKANPWRIQ
HALATYIRSLSPFSSKLDKYMQGDKTQLNVQEKSGFNLFMGKGKCGTCHFAPLFNGTQAP
LFQKSEAEVLGVPAHPDTANAKIDKDEGRFTLNPYPQYKYAFKTTTLRNLSKTAPYMHNG
VYKTLEEVLNFYNRGGGAGIGIALDNQTLQAEPLNLSPKEIQDIIAFLNTMDDQ
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcatcaaacaaaccatagcatttgtatttattttaaccactactacgctcctc
tctatcttttgcacgcaaaaacagccagcagcagaactggtaaaaacccgttttaataaa
gaactgaccttgcttcaaaccatcgtaaacaaagatctttttactgcagtacagcagaaa
aataagaaaaaaataaaaaaagcctttatcgcggcaagggcacaatataaaaaaatagaa
tattatgtagcgtattttttcccttccacctctgaaatgatcaatggagctcccatcgat
gaaatagaattgggtgaaaacctgatagaaaagcctacaggcttccaggtaatggaagag
ctgatctatgaaacaccgacaactgaaaaccgggacgagctgctcaaccaggtcaggaaa
atgcagctgaacttaaagcgtatggaccggtacaaccagcaatatgaaattacagatgca
caaatattcgatgccatcagactcgagattttccgcatcaccagtctggggattacaggc
ttcgacagccctgcagccttgcaatctttgcccgaagcagcagcagcgcttattggcatt
acaaatgcattaaacacatacggagcaaatgatgacctggataaagcacttaaaactgca
attgcacaactaagtactgcaaaagattttaacgactttaacaggcttgactttataacg
ttacacctgcaacccatcagcatcaaagcagatcagctacgtcaggaattgaagatcaat
accgcagccagcggctctgccctgcaggatgatgcggtaagtatgtttcaaaagaatgcc
tttaatctcaataaatttgttggcaactatacggaatacataactaaagacaagaccacc
ctggggaaattgctgttcaacagtaacattttatccagggccggaaaccgcagctgcgcc
agctgtcatcatgaggctaaagcatttactgacggacttgtaactgctaagggattaaaa
ggaacacttttacgaaataccccgactttaatttatgctggactgcagcgtggttttttt
tacgatcttaaagcaggttccctggaagaccaggccctggatgttgtacaccataaaaac
gaaatggacggttcattaacagcagcggccaaaaaaattaatcaggacaaaatgtacgca
acatcatttgcaaaagcctttaacgacaaaactggtaaagccaacccatggcgcatccag
catgcactggccacctatatccgctccctttctcctttttcatctaaactggacaaatat
atgcagggggataaaacccagctaaatgtgcaggaaaaatccgggtttaacttgtttatg
ggaaaaggtaagtgcggaacctgccactttgcgcccttatttaatggtactcaggcccca
ttgtttcagaaaagtgaagcggaagtattgggcgtaccggcgcatcctgatacagctaat
gctaaaattgacaaagatgagggccgttttacacttaatccttatcctcaatataaatat
gcctttaaaactactacactgcgtaacctttcaaaaacagcgccttatatgcacaacggg
gtgtacaaaacacttgaagaggttttaaatttttacaatcgtggtggaggtgccggtatt
gggattgcgctagacaaccagaccctgcaggcagagcctttaaaccttagccccaaagaa
atacaggacatcattgcatttttaaacacaatggatgatcaataa

DBGET integrated database retrieval system