KEGG   Pedobacter heparinus: Phep_2757Help
Entry
Phep_2757         CDS       T00978                                 

Definition
(GenBank) glycoside hydrolase family 2 sugar binding
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
phe  Pedobacter heparinus
Pathway
phe00052  Galactose metabolism
phe00511  Other glycan degradation
phe00600  Sphingolipid metabolism
phe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Phep_2757
  Lipid metabolism
   00600 Sphingolipid metabolism
    Phep_2757
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Phep_2757
Enzymes [BR:phe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Phep_2757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N DUF4982 Glyco_hydro_2 BetaGal_dom4_5 Invasin_D3 Big_1
Motif
Other DBs
NCBI-ProteinID: ACU04958
UniProt: C6Y131
Position
complement(3258935..3261352)
Genome map
AA seq 805 aa AA seqDB search
MMLRKNLVLLLLMLTVGAVAYGTPRIRQNFNQDWKFFLGDDAAAKLPGFKDGKWRTLTLP
HDWSIEGKFDEKNPAKPEGGGLPTGIAWYRKTFTLPASMQKKDVFIEFDGVYKNSEVWIN
GHLLGKRPYGYISFRYELTKYLKTGQNVIAVRVDNAAQPDSRWYSGSGIYRNVWLTATGK
VAVNQWGTFVSTPSVSKTSANVYIKTQIRNKERVKAKIDVKWEVHDADGKVVSATEMKDI
SLKDTLFEVAEFARVNNPKLWSVKQPYLYKVMTRVFVNKTLTDTYETPLGIRYFNFDAKK
GFFLNGESLKILGVCMHHDLGALGAAVNVRAMERQLEILKEMGCNAIRTAHNPPAPELLD
LCDKMGFLVMDEAFDIWAKKKNKQDYHLDFPEWHQRDLQDMVKRDRNHPSIILWSIGNEI
REQFDSTGVALTRSLVKMVKDVDATRPVLSALTETDSAKNFIYQAKALDIYGLNYNHKLY
KDFPKNYPGQTLLPSETTSAFATRGFYDMPSDSIRRWPKDGKTKFTDGNAAWAVSAYDNV
SAYWGSTHEETWKEAKKYAHVPGIFVWSGFDFLGEPIPYPWPARSSYYGIIDLAGFPKDA
YYMYQSEWTSKPVLHLFPHWNWTPGKKIDVWAYYNNADEVELFLNGKSLGTKSKQGEELH
VVWPVNFEAGTLKAVSRKNGQVVLIREIKTAGKPAKIELIADRTTITADGKDLSFVTVRI
LDADGNPVPDAANRVQFKLEGEGTIAGVDNGFQASLEPFKAYYRKAYNGLCLAIVQAKTK
AGKLTLTASSEGLQQAVVTITLKGK
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgatgttaagaaagaaccttgttttattgttgctgatgctgactgttggggctgttgca
tatggcaccccgcgtatacgccagaattttaaccaggactggaagttttttctgggtgat
gatgctgcggcgaaattacccggttttaaggatggtaaatggaggacacttaccttgccc
cacgactggagcattgaagggaagtttgatgaaaagaatcctgcaaaaccggaaggtggg
ggattacctacgggtattgcctggtacaggaaaacatttacattaccggcgtccatgcaa
aaaaaagatgtttttattgagtttgatggggtgtacaagaacagtgaggtttggatcaat
ggtcatttactggggaaaaggccctatggttatatttcgttccgttacgaactcacaaaa
tatttgaaaacgggccaaaatgtcattgctgtaagggtagacaatgctgcccagcccgat
tcgcgctggtactcaggatccggaatttaccgtaatgtctggttaacggctaccggaaag
gttgcagtgaaccaatggggtacatttgtttctacaccctcggtaagtaaaacctcggca
aacgtttacatcaaaacccagatcagaaacaaagagcgggtaaaagctaagatcgatgtg
aaatgggaagtacatgatgcagatggcaaagtggtatctgctacggaaatgaaggacata
tccttaaaagacaccttgtttgaagtagcagaatttgccagggtaaacaaccctaagctg
tggtcggtaaaacagccgtacctttataaagtaatgacccgggtatttgtcaataagaca
ttaacagatacttatgaaactccactgggcatccgctattttaactttgatgccaaaaaa
ggatttttcctgaatggtgaatccctgaaaatcctgggggtttgtatgcaccatgacctg
ggtgcactgggtgctgcggtgaatgtaagggccatggagcgccagctggaaatattgaaa
gagatgggctgtaatgccatacgtacggcacataacccaccagctccggaattacttgat
ctttgtgataaaatgggattcctggtaatggacgaagctttcgatatatgggctaaaaag
aagaacaaacaggattatcatcttgattttccggaatggcaccagcgcgaccttcaggac
atggtgaaaagggacagaaaccacccttctattattttatggagcattggcaatgagatc
cgtgagcagtttgacagtaccggggtggctttaaccaggtcattggtaaagatggtaaag
gacgtagatgccacacgtccggttttatcggcattgacagaaacagattctgcgaagaac
tttatttaccaggccaaagccctggatatttacgggttaaattataaccataaactgtat
aaggattttccaaagaactatcccggacagacattactgccttcagaaacaacttctgca
tttgctacccgcggtttttacgacatgccatccgacagtatccgccgctggcctaaagat
gggaaaaccaaatttacagacggaaatgcagcctgggcagtttctgcttatgataacgtt
tctgcatattggggttctacacatgaagaaacctggaaggaagcaaaaaaatatgcccat
gtaccagggatttttgtatggtcaggattcgattttttaggagagccaataccttatcct
tggccggcaagaagttcttactatggcatcattgacctggctggctttcctaaggatgcc
tattatatgtaccagagtgaatggaccagtaaaccggtactgcacctgtttccgcactgg
aactggactccgggtaaaaagatagatgtttgggcctattacaacaatgcggatgaggta
gaactgttcctgaatggaaaatctttgggtaccaaaagtaaacagggagaagaactacac
gtagtatggccggttaattttgaagcaggtactttaaaagcggtgtcaaggaaaaacggg
caggtggtgctgatcagagagattaaaactgctggaaagcctgcaaagatagaactgatt
gccgacaggactactataaccgcagacggtaaagacctttcttttgtaacggtaaggatt
ttagatgcagatggcaatccggtgccggatgcagccaatagggtacagtttaaactggaa
ggtgagggcacgatagctggtgtagataatggttttcaggccagtctggaacctttcaaa
gcctattaccggaaagcctataacggactttgccttgctattgtacaagcaaaaaccaaa
gccggaaaattaacattaacggcctcttcagaaggtttacagcaggctgttgtaacaatt
accttgaaaggcaaataa

DBGET integrated database retrieval system