KEGG   Pedobacter heparinus: Phep_3023Help
Entry
Phep_3023         CDS       T00978                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
phe  Pedobacter heparinus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Phep_3023
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Phep_3023
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Phep_3023
Enzymes [BR:phe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Phep_3023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3615375..3616145)
Genome map
AA seq 256 aa AA seqDB search
MNRLQQLFQEKKNILSIYYTAGYPNLGDTLAIAEELEKSGANLLEIGFPYSDPVADGPII
QASSKQALDNGMDLKLLFQQLKDLRKTVSIPVLLMGYVNPVLQFGVENFCKACAEVGVDG
CIVPDLPMVEYERLYQPVFAKYGLSNIFLITPQTAADRIQKIDSLSNGFIYLLSSSATTG
QNLQVSNHTEAYFSRIADLKLKNPTMIGFGISSKETFDKACEYANGAIIGSAFVKALDTS
NLKGSIETFMQNFKQD
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaacagattacaacaattatttcaggaaaagaaaaatatactttcaatatattacaca
gctggttatcccaatttaggcgatactttagctattgcagaagaattggaaaaatcaggg
gccaatctattggaaattggttttccttattcagatcctgtagcagatggaccaattata
caggccagcagcaagcaggcgctagataatggaatggatcttaaactcctgtttcagcaa
ctaaaagatttgcgtaaaaccgtcagtatacctgttttattaatgggctatgtaaacccg
gtgttacagtttggtgtcgagaatttctgtaaagcctgtgctgaagttggagtagatggt
tgcattgtccccgatttgcctatggtagaatacgaaagactttaccagccagtttttgct
aaatatggtttaagcaatatattcctgattactccgcaaacggctgcagaccgcattcag
aaaatcgatagtttaagtaacggattcatctatctgttatcttcatcggcaacaaccggg
caaaatctgcaggtatctaaccatactgaagcctatttttcaaggatagcagatcttaaa
ttaaagaacccaactatgattggttttggtatcagtagtaaagaaacctttgataaagcc
tgtgaatatgccaatggggctattataggtagtgcatttgtaaaagcgctggatacaagc
aatttaaaaggaagtattgaaacctttatgcaaaattttaagcaggattaa

DBGET integrated database retrieval system