KEGG   Pedobacter heparinus: Phep_3023Help
Entry
Phep_3023         CDS       T00978                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
phe  Pedobacter heparinus
Pathway
phe00260  Glycine, serine and threonine metabolism
phe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
phe01100  Metabolic pathways
phe01110  Biosynthesis of secondary metabolites
phe01130  Biosynthesis of antibiotics
phe01230  Biosynthesis of amino acids
Module
phe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Phep_3023
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Phep_3023
Enzymes [BR:phe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Phep_3023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACU05221
UniProt: C6Y2L1
Position
complement(3615375..3616145)
Genome map
AA seq 256 aa AA seqDB search
MNRLQQLFQEKKNILSIYYTAGYPNLGDTLAIAEELEKSGANLLEIGFPYSDPVADGPII
QASSKQALDNGMDLKLLFQQLKDLRKTVSIPVLLMGYVNPVLQFGVENFCKACAEVGVDG
CIVPDLPMVEYERLYQPVFAKYGLSNIFLITPQTAADRIQKIDSLSNGFIYLLSSSATTG
QNLQVSNHTEAYFSRIADLKLKNPTMIGFGISSKETFDKACEYANGAIIGSAFVKALDTS
NLKGSIETFMQNFKQD
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaacagattacaacaattatttcaggaaaagaaaaatatactttcaatatattacaca
gctggttatcccaatttaggcgatactttagctattgcagaagaattggaaaaatcaggg
gccaatctattggaaattggttttccttattcagatcctgtagcagatggaccaattata
caggccagcagcaagcaggcgctagataatggaatggatcttaaactcctgtttcagcaa
ctaaaagatttgcgtaaaaccgtcagtatacctgttttattaatgggctatgtaaacccg
gtgttacagtttggtgtcgagaatttctgtaaagcctgtgctgaagttggagtagatggt
tgcattgtccccgatttgcctatggtagaatacgaaagactttaccagccagtttttgct
aaatatggtttaagcaatatattcctgattactccgcaaacggctgcagaccgcattcag
aaaatcgatagtttaagtaacggattcatctatctgttatcttcatcggcaacaaccggg
caaaatctgcaggtatctaaccatactgaagcctatttttcaaggatagcagatcttaaa
ttaaagaacccaactatgattggttttggtatcagtagtaaagaaacctttgataaagcc
tgtgaatatgccaatggggctattataggtagtgcatttgtaaaagcgctggatacaagc
aatttaaaaggaagtattgaaacctttatgcaaaattttaagcaggattaa

DBGET integrated database retrieval system