KEGG   Pedobacter heparinus: Phep_3024Help
Entry
Phep_3024         CDS       T00978                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
phe  Pedobacter heparinus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Phep_3024
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Phep_3024
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Phep_3024
Enzymes [BR:phe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Phep_3024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3616165..3617346)
Genome map
AA seq 393 aa AA seqDB search
MSYFVNEKGYYGDFGGAYIPEMLYPNVEELRQNYLKIIEDESFQKEFHQLLKDYVGRPSP
LYLAKRLSKKYNANIFLKREDLNHTGAHKINNTIGQILLAERLGKKRIIAETGAGQHGVA
TATVCALRGLECVVYMGEVDIKRQAPNVARMKMLGAKVVPATSGSKTLKDATNEAMRDWI
NNPVDTHYIIGSVVGPHPYPDMVAIFQSIISEETKKQLIEQTGNDQPDYVLACVGGGSNA
MGMFYHFIEDEKVKLIAVEAGGKGIDSGFSAATTALGKEGVLHGSRSILMQTPDGQVVEP
HSVSAGLDYPGIGPQHAHLFKTGRGLYVSITDDESLQAGLLLTQMEGIIPAIESAHALAY
LEKMTFTGKENVVVCLSGRGDKDMDTYMKYFNL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagttattttgtaaatgaaaaaggttattacggagattttggtggagcttacattccc
gaaatgctgtaccctaacgtagaggaactgagacagaattaccttaaaataattgaggac
gaatcattccagaaagagtttcatcagctgctgaaagattatgtgggcaggccatcccca
ttgtacctggccaaaaggctctcaaaaaagtacaatgcgaatatatttctaaaacgtgaa
gacctgaaccatactggtgcccataagatcaacaataccatcgggcagatcctgctggca
gaacgccttgggaaaaaacggatcattgccgaaactggtgcagggcaacatggggtggct
acagccacagtttgcgcattacgtggcctggagtgcgtggtatatatgggggaagttgac
attaagcgccaggcccctaatgtggcccggatgaaaatgctgggtgctaaagtagtgccg
gcaacctcaggtagtaaaactttaaaagatgcaaccaacgaggcgatgcgtgattggatc
aataatcccgtggatacccattatattataggatctgtagtcggtccccatccttatccg
gatatggtggctatttttcaatccatcatatccgaagaaactaagaaacaacttatagaa
caaaccggaaatgaccagccggattatgtgctggcctgtgtaggtggtggtagtaatgcg
atgggcatgttttatcattttatagaggatgaaaaagttaaactgatcgctgttgaagca
gggggtaaggggattgatagtggattttcagcggctactacagctttgggtaaagaaggt
gtactgcatggaagcagaagcattttgatgcaaacaccggacggacaggtggtagaacca
cattctgtatctgcaggtctggattaccctggcattggccctcagcatgcgcatttattt
aaaacggggcgtggcctgtatgtgtccattaccgatgatgaatctttacaggcaggtttg
ttgcttacccagatggaaggtattattccggcaattgaaagtgcgcatgcactggcttat
ttagagaaaatgacctttaccggtaaagaaaatgtagttgtttgtctttcaggaagagga
gataaagacatggatacctatatgaaatactttaatttataa

DBGET integrated database retrieval system