KEGG   Pedobacter heparinus: Phep_3073Help
Entry
Phep_3073         CDS       T00978                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
phe  Pedobacter heparinus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:phe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3671782..3672276)
Genome map
AA seq 164 aa AA seqDB search
MQLDSENVYLLLGSNLGDRSELIKEAIEQIDKRIGQVFLTSAFYETSAWGKEDQPAFLNV
AVGVNTALSPIQVLEMVLQIELDLGRVRHEKWGSRLIDIDIVLFGNKIVDNGSQLQIPHP
QMQHRKFVLVPLAEIAPDSIHPVFKLTVSEILERLSDNLSVSKV
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcaattggatagtgaaaatgtttatttgttacttggaagtaacctgggagataggagt
gaattgataaaagaggctattgagcaaattgacaaacgtattgggcaagtatttttaaca
tctgccttttatgaaacatcggcctgggggaaagaagaccagccggcttttttgaatgtt
gccgttggcgttaataccgcgcttagtccaattcaggtacttgagatggttttgcagatt
gaacttgatctgggtagggtgagacatgaaaagtggggttccaggttgatagacatcgat
attgtgctttttggcaacaaaattgtggataatggaagtcaattgcagattccgcatccg
cagatgcagcatagaaaatttgttttggtgcccctggccgaaatcgcgcctgacagcatt
catccggtgtttaagcttactgtatcggaaatattagaaagattaagtgataatttgtca
gtatcaaaagtataa

DBGET integrated database retrieval system