KEGG   Pedobacter heparinus: Phep_3330Help
Entry
Phep_3330         CDS       T00978                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
phe  Pedobacter heparinus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:phe00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:phe00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3950863..3952320)
Genome map
AA seq 485 aa AA seqDB search
MQLQDILYGVTITDQIGVTNRKVSALVFDSRQVIKDAAFFAIKGTLADGHTYIAATVSAG
AGVVICEVLPAEIAPDVTYIQVANSAVALGRMAANFYGNPSEKLQLTGITGTNGKTTIAT
LLFKLFRALGYKVGLISTVENHINDEVIPATHTTPDPLALNALLQDMVDAGCDYCFMEVS
SHAVVQHRIEGLSFAGGVFSNITHDHLDFHKTFDQYIKAKKAFFDALPASAFALTNLDDK
NGMVMLQNTRAAKKTYALKQLADFKAKVIENSFKGLHLDIDDADVFFKLVGSFNAYNLLA
VYGTAVLLGQEKLDVLTLLSNLTGAEGRFDYITSSQHIIGIVDYAHTPDAVQNVLSTIQD
IRKGTEQVITIIGCGGDRDKTKRPIMAQVACDWSDKVILTSDNPRTENPQTIVEEMEKGV
SPTNKRKTLSIVDRKEAIKTACHLARPGDIILLAGKGHEKYQEINGVRYHFDDKEILTEQ
LNLIS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgcaggatattttatatggtgtaactataactgaccagattggtgtaaccaac
aggaaggtaagtgctttggtatttgattcccgacaggttataaaagatgctgcatttttt
gccataaagggtacattagctgatggacatacctatattgctgctacagttagcgcaggt
gccggggtagttatttgcgaggtattaccagctgaaattgctcctgatgttacctatatc
caggtagcgaacagtgctgtagcattgggtaggatggctgctaatttttatggaaaccct
tctgaaaaactgcagctgactggcattacaggtacaaatggtaaaacaactattgccaca
ttgctttttaaacttttcagggcattgggctataaagttggtctgatctcaactgttgaa
aaccacatcaatgatgaggttattcctgcaacacatactacacctgatccgctggcttta
aatgcgcttttacaggatatggtggatgcaggttgtgattattgttttatggaagtgagt
tcccatgctgtcgttcaacatagaatagaaggtttgagctttgctggtggggtattttct
aacatcacccatgatcatctggattttcacaaaacctttgatcagtatataaaagccaag
aaagcattttttgatgccttgccggcatcggcttttgcactgaccaatctggacgataag
aatggtatggtcatgctgcagaatacaagagctgctaaaaagacctatgccctgaagcag
cttgctgattttaaggccaaggtgatcgagaatagttttaaaggtttgcacctggatata
gatgatgcagatgttttctttaaactggtaggatcttttaacgcctataacttattggct
gtttatggtacagcggtattgcttggtcaggagaagctggatgtgctgactttattgagt
aatttaaccggggcagaaggccgttttgattacattacttccagtcagcatattattgga
atagttgattatgcacatacgcctgatgcagttcagaatgtgctgagtacaatacaggat
atcagaaaaggaacggagcaggtaattaccattataggttgtggtggtgacagggataag
accaagcgtcccattatggcccaggtagcctgcgactggagtgataaggtgatcctcact
tctgacaatccaagaacggaaaacccgcaaacgatagtggaggaaatggaaaaaggtgtt
tcgccaacaaacaagcgtaaaactttaagcatagtagacagaaaagaggcgattaaaaca
gcatgtcatttggccagaccaggtgatattatattgctggcaggaaaaggacatgagaaa
taccaggaaataaatggggtgaggtatcattttgatgataaggaaatattaaccgaacaa
ctaaacttaatcagctaa

DBGET integrated database retrieval system