KEGG   Pedobacter heparinus: Phep_3574Help
Entry
Phep_3574         CDS       T00978                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
phe  Pedobacter heparinus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Phep_3574
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Phep_3574
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Phep_3574
Enzymes [BR:phe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Phep_3574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4252150..4253289)
Genome map
AA seq 379 aa AA seqDB search
MPLKKFNSQKNINMWKYQPFLPLLSKANRISMGEGQTPLVKSRSIGPALGIPDLYFKLEN
LNPTGSYKDRFASAFVSMMKSRKQDLCIATSSGNTGAALAAYCAAANIRCIITVVDGAPD
AKIKQMQVYGASMFMVKDFGKDPELSAEVFSLLNSFALSLDLPLPVSAYCYCPEGMQGVQ
TIAYEIFEQTANAVRHIFCPAGGGGLTLSLAKGVMEYGHRYQLSGLPRVHCVQPEGNDTM
AGPLRNKENVAVQRARSTTAVSGLQVPNVLDGNEVITACRSLGGTGYAVTDTEVFNWHKK
MAQQEGIFCEPAGAVALAGLALAVEKGEVADGEQVVCLVTGSGFKDMLTVEKQFSLPALE
AIDKAAFAVWIEKMKKGKI
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgccattaaaaaaattcaattcccaaaagaatattaacatgtggaagtatcaacctttt
ttaccgctgttaagtaaggccaatcgtatcagcatgggcgaggggcaaactcctcttgtt
aagtccagatccataggcccggcgctgggcataccagacttgtattttaagttggaaaac
cttaatccaacaggttcctacaaggaccgttttgcttccgcttttgtaagtatgatgaaa
agtcggaaacaggatctttgtatagcaacatccagtggcaatacgggtgcggcgttagcg
gcttattgtgccgcggccaatatcagatgcataataaccgtggttgacggggctcctgat
gcgaagattaagcagatgcaggtgtatggagcgtctatgttcatggtaaaagattttggc
aaggatcccgaactaagtgctgaagttttttctttactgaacagcttcgcactttcttta
gatctgcccttacccgtaagtgcatattgctattgtccggaaggaatgcagggggttcaa
accatagcatatgaaatatttgaacaaaccgccaatgctgttcggcatattttctgtccg
gcagggggaggtgggctgactttgtctttggccaaaggcgtaatggaatatggacataga
tatcagctttctggtttgcccagagtgcattgtgtccagcccgaaggtaacgatacgatg
gctggtccgctgagaaataaagagaatgttgccgttcaaagagcacgttctaccacagcc
gtcagtggcttgcaggtgccaaatgtgttagacggcaatgaggtaattacagcttgtcgt
tcacttggcgggacaggatatgctgtaacagacaccgaggtgtttaactggcataaaaaa
atggcccagcaggagggtatattttgtgagccggcaggtgctgtagcacttgcggggcta
gcacttgcagttgaaaaaggagaagtagcggatggagaacaagtcgtttgtctggttacg
ggcagcggttttaaagatatgttaacggtagaaaaacaatttagtctacctgctttggaa
gcaattgataaagcagcttttgcagtttggattgaaaagatgaaaaaaggaaaaatttaa

DBGET integrated database retrieval system