KEGG   Pedobacter heparinus: Phep_4149Help
Entry
Phep_4149         CDS       T00978                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
phe  Pedobacter heparinus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:phe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5023581..5024213)
Genome map
AA seq 210 aa AA seqDB search
MDNHTNHLDEEDNGYIKIDRYNEGKIAAVAHHYKDILGQLGEDPNREGLIKTPERVAKAL
QYLTHGYDLNPAEILRSAMFKEDYSQMVVVKDIEVFSMCEHHMLPFFGKAHIAYIPNGHI
VGLSKIPRIVDAFARRLQVQERLTNEIRDCIQDTLMPAGVAVVIECKHLCMAMRGIQKQN
SVTTTSAFTGEFAKDKTRAEFLRLITANLH
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggataatcatacaaatcatttagatgaggaagataatggctatataaaaatagaccgt
tataacgaaggcaaaatcgctgcagttgcacatcattataaagacatccttggccagctg
ggggaagatccaaaccgtgaaggtttaataaaaacgcctgaacgcgtagctaaggcctta
caatatttaacacatggttatgaccttaaccctgcagagatattgcgttcagcaatgttt
aaagaagattacagccagatggttgtggtaaaggatatagaagttttctctatgtgcgaa
caccatatgctcccgttttttggtaaggcccatattgcttatataccaaatgggcacatt
gtaggcttaagtaaaattccgcgtatagttgatgcctttgcaagaagactgcaggtacag
gagcggcttaccaatgagatcagagattgtatccaggatacgttaatgccagcaggcgtt
gcagtggtgatagaatgcaagcacttatgcatggcaatgaggggcatacaaaaacaaaac
tcagttaccaccacttcggcatttacaggggaatttgcaaaggacaaaacaagggcagag
tttttaagattgatcacagccaatcttcactaa

DBGET integrated database retrieval system