KEGG   Pedobacter heparinus: Phep_4187Help
Entry
Phep_4187         CDS       T00978                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
phe  Pedobacter heparinus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Phep_4187
Enzymes [BR:phe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Phep_4187
Exosome [BR:phe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Phep_4187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5066163..5067653
Genome map
AA seq 496 aa AA seqDB search
MSKFILSFDQGTTSSRAIVFNKEGSIVSIAQKEFEQIYPQPGWVEHNASEIWSTQIAVAT
EAIVKASLTPPDIAAIGITNQRETTVLWDKKTGEPLYNAIVWQDRRTSAYCDELKSKGLA
KKIQEKTGLILDAYFSATKIKWILDNVEGARAKAEAGDIAFGTIDSWLIWKLTDGRVHVT
DVSNASRTMIYNIHTLDWDQELLDLFDIPKNILPEVKSSSEVYGETTGNVLAAKIPIAGI
AGDQQAALFGQMCTEVGMVKNTYGTGCFMLMNIGDKPIVSQNNLVTTIAWKINGKVQYAL
EGSIFIGGAVVQWLRDGLGIISSSAEVETLALKVADTGGVYLVPAFAGLGAPHWNQDARG
TITGITRGTTAAHLARAAIESIAFQTMEVLKAMEADSGHAIKELRVDGGATSNDILMQFQ
ADLLDTTVIRPKVTEVTALGAAYLAGLAVGYWNSMDDISGQWKIDKNFNAGNTDNIAERI
KGWNRAVKAAKANAEN
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtttattttatcctttgatcagggaaccacaagttcaagggcaattgtattt
aataaggaaggaagtattgtatcaatcgcccaaaaggagtttgaacagatctatcctcaa
cctggatgggtagagcataatgccagcgaaatctggtctacccagattgcagtagctacc
gaagcgattgtaaaagccagccttaccccacccgacattgctgctatcggcatcaccaac
cagcgtgaaacaacggtactttgggataaaaaaaccggagagcctttatacaacgccata
gtatggcaagacaggcgtacatctgcctattgtgatgaactgaagtccaaaggactggcg
aaaaaaatacaggaaaaaacagggctgatactggatgcctacttttcggccaccaagatc
aaatggatacttgataacgtagaaggagccagggccaaagctgaagctggtgatattgct
tttggcaccatagattcatggctgatctggaaacttacagatggcagggtacatgttaca
gatgtaagcaatgcttccaggaccatgatctataacatccataccctggattgggaccag
gaactgcttgatctttttgacatccctaaaaatatactccctgaagtcaaatcatcaagt
gaagtttacggggagaccacaggaaatgtacttgccgcaaaaattcctattgccggcatt
gccggtgatcagcaggccgccctgttcggacaaatgtgtactgaagtaggaatggttaaa
aatacttatggaacaggttgctttatgctcatgaacatcggcgataaacccattgtttcg
caaaacaacctggtaaccaccatagcctggaaaataaatggcaaagtacagtatgcttta
gagggaagtatttttattggcggggcagttgtacaatggctaagggatgggctgggcatc
atcagctcttcggccgaagtagaaacccttgcattaaaggtagcggatacaggtggtgtt
tacctggtacctgcatttgccggtctgggtgcaccacactggaaccaggatgcccgcgga
accataaccggtatcacccgtggaactactgctgcacaccttgccagagcagcaatcgaa
agtattgcttttcagaccatggaagtgcttaaagctatggaagctgattcaggacatgcc
attaaagaattacgtgtggatggcggggcaaccagcaacgacatattgatgcagttccag
gccgatttgctggataccacagtaatccgtccgaaagtaacggaagtaaccgctttgggg
gctgcttatttggccggactggctgtaggctactggaacagcatggatgacattagcgga
caatggaaaattgacaagaattttaatgcaggcaataccgataacattgctgaacgtata
aaaggctggaacagggcagtaaaagccgcaaaagccaatgccgagaattaa

DBGET integrated database retrieval system