KEGG   Pedobacter heparinus: Phep_4197Help
Entry
Phep_4197         CDS       T00978                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
phe  Pedobacter heparinus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Phep_4197
Enzymes [BR:phe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Phep_4197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5075550..5076119
Genome map
AA seq 189 aa AA seqDB search
MKQGKLIIFSAPSGAGKTTIVKHLLTKFPSLSFSISATTRELRGDEKNEKDYYFITKEDF
LHKVARQEFVEFEEVYSGTFYGTLRSEIQRIWDEDKHVIFDIDVEGGLRLKRKYENDALA
IFVQPPSLAVLKERLRGRGTDSPEKLQERFVKAEKELAYADKFDVILNNFDLHTACLEAE
KLVGDFIKK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaggtaaactgattatattttctgctccctcgggtgcaggcaaaaccaccatc
gttaaacatttgcttacgaaattcccttcattgagcttttctatatcagcaactacccgg
gagttgcgcggggatgagaaaaatgaaaaagactattattttattaccaaagaagatttt
ctgcacaaagttgcgcgccaggaatttgtagagtttgaagaagtttacagcggaactttt
tacggcaccctgaggtctgaaatccagcgcatctgggatgaagacaaacatgtcattttt
gatattgatgtagaaggtggcttgcgcttaaaacgtaaatatgaaaatgatgcgctagct
atatttgtacaacccccatccttagccgtacttaaagaacgtttaaggggcaggggtacc
gatagccccgaaaagctgcaggagcgctttgttaaagcagagaaagaactggcttatgcc
gataaatttgacgttatccttaacaactttgacctgcatacagcctgtctggaagcagaa
aaactggtaggggattttataaaaaaataa

DBGET integrated database retrieval system