KEGG   Pedobacter heparinus: Phep_4245Help
Entry
Phep_4245         CDS       T00978                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
phe  Pedobacter heparinus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:phe00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Phep_4245
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Phep_4245
Enzymes [BR:phe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Phep_4245
Two-component system [BR:phe02022]
 CheA family
  CheA-CheYBV
   Phep_4245
Bacterial motility proteins [BR:phe02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Phep_4245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5121169..5121750)
Genome map
AA seq 193 aa AA seqDB search
MEKDRLMEKCKALIIGGSAGSLDVLLKVLPVVRPDISFPIIIVVHRKHGTDSLLPVLLST
RTEMRVKEVDEKEAILAGTIYVAPSDYHLLIEQDQTFSLDYSEKINYSRPAIDATFQTAA
EVYRSQLVCLLLSGSNADGVSGLKSVKAWGGTAIIQDPETAQVAYMPAQAKLNVQIDYEL
SIEAIGDFINLLP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagataggctgatggaaaaatgcaaggcacttatcataggcggttctgccggt
agcttagatgtattgctaaaggtattgccggtagtaaggccggacatcagcttcccgatc
attattgtggtgcacagaaaacatggaacagattctttactgcctgttttattgtcgaca
cggactgaaatgagggttaaggaagtggatgaaaaagaggccatattggcgggtaccatt
tacgttgcaccttcggactaccatttgctgattgagcaggaccagaccttttccctggat
tattctgagaaaataaattattcgcgccctgcaattgatgcgaccttccagacggcggca
gaggtgtaccggtcgcagttggtttgcctgttgctttcgggctctaatgccgacggggta
agcgggctgaaaagcgtgaaagcctggggtggaacagctataatacaggatccggagacc
gcgcaggtggcctatatgccggcacaggcaaagctaaatgtgcaaatagattatgaatta
agtattgaagctataggagatttcataaatttgttaccctaa

DBGET integrated database retrieval system