KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102099273Help
Entry
102099273         CDS       T02921                                 

Definition
chymotrypsinogen 2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     102099273
Peptidases [BR:phi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102099273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 268 aa AA seqDB search
MALLWVLSCLALAGFARAALPEDCGVPAIPPVIRGYTRIVNGEPAVPGSWPWQVSLQRYD
GFHFCGGSLISENWVVTAAHCGVRKTDTVVVGAYDQDAPGPDQQKLKIEKVFKNPKFNML
TIHDDITLIKLATPAQLSDRVSPVCLPKATDEFPGGMTCVTTGWGLTDSSASHTPAVLQQ
AALPLLTNTQCKEFWGFRIRDVMVCAGADGASSCMGDSGGPLVCQKDGAWNLVGIVSWGS
STCDPQTPGVYARVTKLRDWIDSILEAN
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctgtgggtgttgagctgcctggcgctggcgggctttgcccgtgccgccctc
cctgaggactgcggcgtgcccgccatcccacccgtcatccgtggctacacccgcattgtc
aacggcgagccggcggtgccagggtcctggccgtggcaggtgtccctccagcgctacgac
ggcttccacttctgcggcggctccctgatcagcgagaactgggtggtcaccgctgcccac
tgcggcgtcaggaaaaccgacaccgtggtggtgggcgcctacgaccaggacgcacccggc
cctgatcagcagaaactgaaaatcgagaaggtcttcaagaaccccaagttcaacatgctg
accatccacgacgacatcaccctgatcaaactggccactccggcgcagctgtcggatcgc
gtgtcccccgtctgcctgcccaaggccaccgatgaattcccgggggggatgacctgcgtc
accactggctgggggctcactgactccagtgcctcgcatacgccggcggtgctgcagcag
gcggctctgcccctgctcaccaacacccagtgcaaggagttctggggcttccgcatccgc
gacgtgatggtctgtgccggcgccgacggagcctcttcttgcatgggcgactccgggggc
ccgctggtgtgccagaaggacggcgcctggaacctggtgggcatcgtctcctggggcagc
agcacctgcgacccccagacgcccggcgtgtacgcccgcgtcaccaagctccgcgactgg
atcgactccatcctggaggccaactga

DBGET integrated database retrieval system