KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102099745Help
Entry
102099745         CDS       T02921                                 

Gene name
TGM4
Definition
transglutaminase 4
Orthology
K05621  
transglutaminase 4 [EC:2.3.2.13]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102099745 (TGM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 824 aa AA seqDB search
MRAGAGAAVAAGVLGAAAGAAAKLALGPGGEAAGGPAILGKVLFGETWTLLWWVGLAMTV
CGLILLHTAAPQLARSRYNQLFYKSLIPVLANQAACRQLATGCVGAQLRAQGGKQGWKTK
AAESNLKVTGIDFLKSQNTRQHHTDGYNIKNLVVRRGQPFQVQVSLSRELRAADKLSLRF
TIGENPMKNRGSLLSLKPEREDFTGWKISVVKKNGKECLLSVTSSPNAPVGKYSLHVKTG
TNIYKPENGVIYLLFNPWCEDDVVYMANEAQKNEYVLNDTGCIYVGSAYNIYDRPWNFGQ
FEEFVLDACMYLLDKSKLSLRERRDPANVSRAMSALVNANDDSGVLMGNWSGNYTNGTSP
MDWIGSVTILQKYYKTKKPVCYGQCWVFAGVLNTVMRCLGVPCRCVSTFDSAHDTEGNLT
VDIYLNEKGEKLNSLSFDSVWNFHVWNDVWMQRKDIPDGFDGWQAIDSTPQEQSQGRFQC
GPCPVKAVREGDVYLPYDSKFVYAEVNADRVYWVVKKVNGKDKYFKVGTETRDVGKKIST
KAVGQNRREDITWEYKYPEGSKEERISMQRAISFLRPSGLIPRSGYASTVQTLSGSSQPL
VPKEPATKTGLHIEITNTEALHPGNPLEMAITVKISAPGNWTVDVTGSCQLQYYTGKVQA
NLGTIKETINLEGTSEMQVPLKIAPDAYMKTLSSVEDEVLILVTAIAEVRETNDKLTKET
SMRFEYPPITVQMPETAQLYNDFTCAFIFKNKLNVTLENCKLLVEGLGLFKMTTFEQGDI
MPGRIMKSEIICTPTRLGERKIVAKLISNQIKGISTEKAITITE
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgggggccggggcggcggtggccgcgggggtgctgggggcggcggcgggcgcc
gcggcgaagctggcgctaggcccgggcggggaggcggccggcggcccggctatcctggga
aaagtgctcttcggggagacgtggacgcttctgtggtgggtcggcctcgccatgacagtc
tgcgggctcatactgctgcacacggctgcaccccagctggcacgttctaggtataatcag
ctcttctataaatcactaattcccgtgctggcaaaccaagctgcctgcaggcagctggcc
acagggtgtgtgggggcccagctccgtgcccagggcgggaagcagggctggaagacaaaa
gcagcagagtccaatctgaaggtcactgggattgactttctgaagagccagaacacgcgg
cagcaccacacggatggctacaacatcaagaacctggtggtgcggcgcggccagcccttc
caggtgcaggtcagcctcagcagggagctgagggctgccgacaagctgtccctgcgcttc
accatcggtgaaaatcctatgaaaaacagggggagcctgctgtcgctgaaaccggagcgg
gaggatttcactgggtggaagatctcagttgtcaagaagaatggcaaagagtgtctgctg
tctgtcaccagctcacccaatgcccctgtgggaaaatacagcctgcatgtgaagactggc
actaacatttacaagcctgaaaatggtgtcatctaccttttgttcaatccttggtgtgaa
gatgatgttgtctacatggccaatgaggcacagaagaatgaatacgtgctcaacgacacc
ggctgcatctatgttgggtctgcatacaacatctacgacaggccctggaattttgggcag
tttgaggaatttgtcttggatgcctgcatgtatctgctggacaaaagcaagctcagtctg
agagagagaagggatcctgcaaatgtgtccagagccatgtctgctttggttaatgccaac
gatgacagcggagtcctgatggggaactggtcagggaattacaccaatggaacatcccct
atggattggattgggagtgtcacaattttgcagaagtactacaaaacaaaaaagccggtc
tgttatggccagtgctgggtcttcgcaggagtcctcaatacagtcatgcgttgcctggga
gtgccatgccgctgtgtgagtacctttgactcggcccacgacacagaggggaacctgaca
gttgacatttacctgaatgaaaaaggagaaaagctgaactcgctgtccttcgactctgtc
tggaacttccacgtgtggaatgatgtctggatgcagagaaaagatattccagatgggttt
gatggctggcaggcaattgattcaacccctcaggagcaaagtcaaggtcgtttccagtgt
ggcccatgcccggtgaaggctgtccgggaaggagatgtgtatttgccctacgacagcaag
tttgtgtacgcagaagtgaacgctgacagagtctactgggttgtcaagaaggtgaatggc
aaagacaagtacttcaaggttggcaccgagacccgagacgtcggcaagaagatcagcaca
aaagccgtggggcagaacagacgggaagacatcacctgggagtacaagtaccccgaaggc
tccaaagaggaaaggatatctatgcaaagagctatcagcttcctacgcccttcgggattg
atacctcgttcaggctatgcttcgactgtgcagacactaagtgggagcagccagcctttg
gtcccaaaggagccagccaccaagactgggctccacattgagataaccaatacagaagct
ttgcatcctggcaatccccttgaaatggccatcacagtgaagatctctgctcctgggaac
tggaccgttgacgttactggctcctgccagctgcagtactatactgggaaagttcaggcc
aatcttggaactatcaaggagaccatcaacctagaaggcacatctgagatgcaggtcccc
ctgaaaatagcacctgatgcatacatgaagacgctgtcctctgtggaagatgaagtgctc
atccttgtcactgccattgctgaggtcagggaaacaaatgacaaactcaccaaggagacc
tccatgagattcgagtatccccccatcactgtccagatgccagaaacagcccaattgtac
aatgacttcacctgtgcattcatcttcaagaacaagctgaatgtgaccctggaaaactgc
aagctgctggtggagggcttgggcttgtttaagatgacaacatttgagcagggggatata
atgcctggcagaatcatgaagtctgaaataatatgcactccaacaagactaggagagagg
aaaatcgtagccaagctgatctcaaaccagatcaaagggatctctacagagaaggccatc
accatcaccgagtag

DBGET integrated database retrieval system