KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102100446Help
Entry
102100446         CDS       T02921                                 

Gene name
GLS
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102100446 (GLS)
   00330 Arginine and proline metabolism
    102100446 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    102100446 (GLS)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     102100446 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 676 aa AA seqDB search
MMRLWRSALLRELLLLGPPGAAGGGAPVPGPAAATRRLPPPFAALGASPPAARRGPAALP
SARSLCTRSEGALEEPGKGAQAPSPSPGESPADSGHNNNHGGAGKEVAVGGGGENKIKQG
LLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVM
LDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLA
KFSPDLWGVSLCTVDGQRHSVGDTKVPFCLQSCVKPLKYAIAVNDLGTEYVHRYVGKEPS
GLRFNKLFLNEDDRPHNPMVNAGAIVITSLIKQGANNAEKFDYVMQFMNKMAGNEYVGFS
NATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVAILDFYFQLCSIEVTCESASVMAATL
ANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPN
VMGLMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRREGGDQRVKSV
INLLFAAYTGDVSALRRFALSGMDMEQRDYDSRTALHVAAAEGHVDVVKFLLEACKVNPF
PKDRWNNTPMDEALHLDTMMFLKFFKSIRSSTRHQRITTMGKRTERFIKIWMAYYNHLQL
DPKNQITYLFNCGMHK
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggctgtggcggtcggcgctgctccgggagctgctgctgctcggcccaccgggg
gcggccggcggcggggccccggtcccgggacccgccgccgcgaccaggcgccttccgccg
ccgtttgccgccctcggcgccagcccgcccgccgcccgtcgcggcccggcggcgctgccg
tcagcgcgaagtctgtgcacccgctccgagggagccttggaggagccggggaagggggcg
caggcgccgtcgccgagtcccggcgagtcccccgccgatagcggccacaacaataaccac
ggcggcgccggcaaggaggtggccgtaggcggcggcggggagaataaaataaaacaaggt
ctccttcccagcttagaagatctacttttctatactattgcagaaggacaagaaaaaata
ccagttcataaattcataactgcactcaaatctacaggattacgtacatctgatcctcga
ttgaaagagtgcatggatatgctaagactgactcttcagactacttcagatggtgttatg
ctggacaaagacctttttaaaaagtgtgtacaaagtaatattgtgttgcttactcaagct
ttcagaaggaagtttgtcattccagattttatgtcgtttacttcccatattgatgagcta
tatgaaagtgctaaaaaacaatctggaggaaaggttgctgactatattccacaactggcc
aagttcagccccgatttgtggggggtgtcactttgcaccgtcgatggacagaggcattct
gtgggtgataccaaagttccattttgtcttcagtcctgtgtaaagcctttgaaatacgcg
attgctgtcaatgatcttggtacagagtatgtgcacagatatgttggtaaagagcctagt
ggattaaggttcaacaaactgttcctgaatgaagatgacaggcctcataaccctatggtg
aatgctggagcaattgtgatcacatctttaatcaagcaaggagcaaataacgcagaaaaa
tttgactacgtgatgcagttcatgaataaaatggctggtaatgagtatgttggattcagt
aatgctacgttccagtctgaaagagagagtggagatagaaactttgcaattggatattac
ttgaaagaaaaaaagtgctttcctgaaggcacggatatggtcgctatactagacttctat
tttcagctttgctcaatagaagtaacatgcgagtcagcaagtgtgatggcagcaactctg
gctaatggtggcttttgcccaatcactggtgagagagtcctgagccctgaagcagtccgg
aataccttgagtttgatgcattcctgtggcatgtatgacttttcagggcagtttgccttc
catgttggtcttcctgcaaaatctggagttgctggtgggattcttctggttgttcctaat
gtcatgggcttgatgtgctggtcacctcctttggacaagatggggaacagtgttaaagga
attcacttttgtcatgatctggtttccttgtgcaatttccataactacgataatttgaga
cactttgcaaaaaagcttgatcctcgcagagaaggcggtgatcagcgggtgaagtctgtg
ataaatctgctgtttgctgcctacacaggggacgtgtctgcactccggaggtttgctctg
tcaggaatggatatggagcaaagagactatgactcacggacagccctgcacgtggcagct
gcagaaggacacgtggatgttgttaaatttctactggaagcatgcaaagtgaatcctttc
cccaaagacaggtggaataacactcctatggatgaagctttacatttggacaccatgatg
tttttaaaattcttcaagagtatcaggtccagtacacgccatcagaggataacaacgatg
ggaaagagaaccgaacggttcataaaaatctggatggcttactataatcatcttcagcta
gatcctaagaatcaaatcacttacctatttaattgtggtatgcataagtaa

DBGET integrated database retrieval system