KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102100634Help
Entry
102100634         CDS       T02921                                 

Gene name
KAT2A
Definition
(RefSeq) lysine acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102100634 (KAT2A)
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102100634 (KAT2A)
Transcription machinery [BR:phi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102100634 (KAT2A)
Chromosome [BR:phi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102100634 (KAT2A)
   HAT complexes
    PCAF complex
     102100634 (KAT2A)
    STAGA complex
     102100634 (KAT2A)
    TFTC complex
     102100634 (KAT2A)
    SAGA complex
     102100634 (KAT2A)
    SLIK complex
     102100634 (KAT2A)
    ADA-HAT complex
     102100634 (KAT2A)
    HAT-A2 complex
     102100634 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 796 aa AA seqDB search
MAEPEASQPGRPPPGPGTGTAGASGGTAGGAGSSDPARPGLSQQQRASQRKAQVRGFPRG
KKLEKLGVFSACKANDACKCNGWKNPNPPTAPRMDLQQPVTNLSEACRSCGHALADHVSH
LENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMSQPVVEGS
LGSPPFEKPNIEQGVLNFVQYKFSHLPPKERQTMYELSKMFLLCLNYWKLETPSQFRQRS
QNDDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLKSIFTVTRRQLLEKFRVE
KDKLVPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTVPATEGAQLVSRPAVVSTVA
VPTTPLFSKKLSSSSSAASLDSSTPEPLPGEKRKLPESLTLEDAKRIRVMGDIPMELVNE
VMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLV
GLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAV
TSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGY
IKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLTCFKEGVR
QIPIESVPGIRETGWKPLGKEKGKELKDPDQLYNMLKNLLAQIKTHPSAWPFMEPVKKSE
APDYYEIIRFPIDLKTMTERLKNRYYVTKKLFIADLQRIITNCREYNPPDSDYCKCANTL
EKFFYFKLKEGGLIDK
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccggaggcctcgcagcccgggcggcccccgccgggcccggggacgggaacg
gcgggggcgagcgggggaacggccggaggagcgggatccagcgacccggcacggcccggg
ctgagccagcagcagcgggcgagtcagcgcaaggcgcaggtgcgggggttcccccgcggg
aagaagctggagaagctgggggtcttctcggcctgcaaggccaacgacgcttgcaaatgc
aatggctggaagaacccaaacccccccacagcccctcgaatggacctgcagcagccggtg
accaacctgagcgaagcgtgccggagctgtggccatgccctggcggatcatgtgtcccac
ctggagaacgtctcggaggaagagatcaaccgtctgctgggcatggtggtggacgtggag
aacctgttcatgtcagtgcacaaggaggaggacacggacaccaagcaggtgtatttctac
ctgttcaagctgctgcggaagtgcatcctgcagatgagccagcctgtggtcgaggggtcc
ctggggagccccccctttgaaaaaccaaacattgagcagggagtcctgaattttgtgcag
tacaagttcagccacttgccacccaaggagcgccagaccatgtatgagctctccaagatg
ttcctgctgtgcctcaactactggaagctggagacaccgtcccagttccgtcagcgctcc
cagaacgacgatgtggccacctacaaggtcaactacaccaggtggctgtgctactgccat
gtgccacagagctgtgacagcctgccccgctatgagaccacccacgtctttgggcgcagc
ctcctcaagtccatcttcacggtgacccgccggcagctgctggagaagttccgggtggag
aaggacaagctggtgccggagaagcggacactgatcctcacccactttcccaagttcctc
tccatgctggaggaggagatctacggtgagaactctccaatctgggaggctgatttcaca
gtgccagctacagagggtgcccagctggtgtctcgcccagctgtggtgagcaccgttgcc
gtgcccaccactcctctcttcagcaagaagctcagcagcagcagctcagctgccagcctg
gactccagcaccccagagcccctgccaggagagaagcggaagctacctgagagcctgacg
ctggaggatgccaagcggatccgtgtcatgggagacatccccatggagctggtgaacgag
gtcatgctaaccatcacggaccctgctgccatgctgggccccgagaccagcctgctgtcg
gccaacgcggcgcgggatgagacggcgcggctggaggagcgccgcggcatcatcgagttc
cacgtcatcggcaactcgctctcacagaaatccaacaagaagatcctgatgtggctggtg
gggctgcagaatgtcttctcacaccagctgccccgcatgcccaaggagtacatcactcgc
ctcgtctttgacccgaagcacaagaccctggcactgatcaaggacggacgagtgatcggg
ggcatctgcttccgcatgttccctacccaaggtttcacggagattgtgttctgtgctgtc
acctccaatgagcaagtgaagggctatgggacgcacctgatgaaccacctgaaggagtac
cacatcaagcacaacatcctctacttcctcacctatgcagatgagtacgccattggctac
ttcaaaaagcagggcttttctaaggacatcaaggtccccaagagccgctacctgggatac
atcaaggactacgagggggcgaccctgatggagtgtgagctgaacccccgcatcccctac
actgagctttcacacatcatcaagaagcagaaggagatcatcaagaagttgatcgagagg
aaacaggcccagatccgcaaagtctatccaggcctgacctgcttcaaggagggcgtgagg
cagatccccatcgagagcgtccctggcatccgagaaacaggatggaaaccactggggaag
gagaaggggaaggagctgaaggacccagaccagctctacaacatgctgaagaacctcctg
gcccagatcaagacccaccccagtgcgtggcccttcatggagccggtgaagaagtcagag
gcaccagactactatgaaatcatccgcttccccattgacctgaagaccatgacggagcgc
ctgaagaaccgctactacgtcaccaagaagctgttcatcgccgacctgcagcgcatcatc
accaactgccgcgagtacaacccgcctgacagcgactactgcaagtgtgccaacaccctc
gagaagttcttctacttcaagctcaaggaaggggggctcatcgacaagtag

DBGET integrated database retrieval system