KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102100687Help
Entry
102100687         CDS       T02921                                 

Definition
lysozyme C-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102100687
Exosome [BR:phi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102100687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 149 aa AA seqDB search
MRKSMLFLGFLVCLGLALPGTQGRIISKCEMVKILRRNGFEGFEGTTVADWMCLVKYESG
YNTKAYNNNGPSRDYGIFQINSKYWCNDGRTPGSVNACHISCSKLQDDNIDDDIRCAKKI
AREAHGLSPWYGWKNHCKGRNLSSYVRGC
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtcaatgctcttccttggctttcttgtttgccttggcctggctctgccaggt
acccagggaagaataatttccaaatgtgagatggtgaagatcttacgtcggaatggcttt
gagggctttgagggcacaactgttgctgactggatgtgcctggtgaaatatgagagtggt
tataacacgaaagcgtacaataacaatggtccaagcagggactacggcatctttcagatc
aacagcaagtactggtgcaatgatggcaggacccctggatctgtgaatgcctgccacatc
agttgctcaaaactgcaagatgataacattgatgatgatattcgctgtgccaagaagatt
gctcgggaggctcatggcctcagtccctggtatggctggaaaaatcattgcaagggcaga
aacctgagttcctatgtcagaggatgttaa

DBGET integrated database retrieval system