KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102100810Help
Entry
102100810         CDS       T02921                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:phi00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 619 aa AA seqDB search
MQNSKSKPCSCPSLKLREMVSMYFTMVAAFLVILVVALQGSVPHESDFPYTVPLDPQGLL
ELSWNVSYPEQAVHFQLLIRDLQFGLLFGMSDRGEFENADLAVLWSDGHNSYFGDAWSDA
RGQLHMDSQQDYQLLGARRAPEGLYLLFRRAFSTCDPKDYLIEDGTVHLIYGILEKPVHS
LQAINVSALHGGLQRVQLLKPNISIPELPSDMKTMEITAPDVVIPSQETTYWCYMAELPE
GFPKHHIIMYEPVVTAGNEALVHHMEVFQCAAEFDSFPHYNGPCDSKMKPERLNYCRHVL
AAWAMGAQAFYYPEEAGLAFGGPGSSRYLRLEIHYHNPLVFKGRRDSSGIRLYYTATLRP
YDAGIMELGLVYTPVMAIPPGEDNFILTGYCTDKCTQLALPAAGIRIFASQLHTHLAGRK
VVTVLSRDGRERQVVNADRHYSPHFQEIRMLKEVVAVFPGDELITTCTYNTEDRSRATVG
GFGILEEMCVNYVHYYPQTQLELCKSAVDPGYLHRYFNLVNRFNDEEICMCPQVSVPQQF
YSIPWNTFNRDVLKSLYGFAPISMHCNKSSAVRFPGEWEKQPLPRITGRLREPGPRCPPA
PGPQPAVPVPLQLSQLRRD
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgcagaattccaagagcaagccctgctcctgccccagcctcaagctgcgggagatggta
tccatgtacttcaccatggtggcggcgttcctggtcatcctggtggtggctctgcagggc
tcggtgccccacgagagtgatttcccctacacggtgcccctggatccccaggggctgctg
gagctctcctggaacgtcagctaccccgagcaagctgtgcatttccagctcctcatccgg
gacctgcagttcgggctcctcttcgggatgtcggacaggggcgagtttgagaacgcggac
ctggccgtgctctggagcgacgggcacaactcctactttggggatgcctggagcgatgcc
agggggcagctccacatggattcccagcaggactatcagctccttggggctcgcagggct
cctgagggcctctacctcctcttcagaagagccttcagcacctgtgaccccaaggactac
ctgatagaggatggcaccgtgcacctgatctacggcatcctggagaaaccggtgcattcc
ctgcaagccatcaacgtctctgccctccacggggggctgcagagggtgcagctgctaaaa
cccaacatcagcatccctgagctgcccagtgacatgaagaccatggagataacagcccca
gatgttgtcattcccagccaggagacgacctactggtgctacatggcagaactcccagag
ggcttccccaaacaccacatcatcatgtacgagccagtggtcacggcgggcaacgaggct
cttgtccaccacatggaagttttccagtgcgcggccgagttcgacagcttcccccactac
aacgggccctgtgactccaagatgaagccagaacgcctcaactactgcagacacgtgctg
gcagcttgggccatgggagcacaggctttctattaccctgaagaagcaggtcttgccttt
ggtggcccaggctcctccagatatttgcgtctggagatccattaccacaatcccctggtg
ttcaaaggtcgccgtgactcctcagggatccgtctgtactacacggccacgcttcgtcct
tatgatgctggaatcatggagctgggcttggtgtacaccccagtgatggccattccccct
ggagaggacaacttcatcctcacagggtactgcactgataaatgcacccagctggctctt
cccgctgccggcatccgcatctttgcctcccagctccacacacacctggcagggaggaaa
gtggtgacggtgctgtcccgggacgggagggagcggcaggttgtgaatgctgacagacac
tacagccctcacttccaggagatccgcatgctgaaggaagtggtcgctgtttttccaggc
gatgaactcatcaccacctgcacatacaacaccgaggatcggagcagagccaccgtggga
gggtttggcatcctggaagagatgtgtgtgaactacgtgcactactacccccagacccag
ctggagctgtgcaaaagcgctgtggatccaggctacctgcaccgctacttcaacctcgtg
aacaggtttaacgatgaggagatctgcatgtgcccacaggtgtctgtcccacagcagttt
tactccatcccctggaacaccttcaacagggatgtgctgaaatccctctacggctttgct
ccgatctccatgcactgcaacaaatcctctgcagtccggttcccgggcgagtgggagaag
cagccgctgccccgcatcaccgggaggctccgggagcccggcccccgctgcccgcccgcc
ccgggacctcagcccgctgtccccgtccccctccagctgagccagctccgcagggactga

DBGET integrated database retrieval system