KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102101707Help
Entry
102101707         CDS       T02921                                 

Gene name
CHKA
Definition
choline kinase alpha
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    102101707 (CHKA)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     102101707 (CHKA)
    2.7.1.82  ethanolamine kinase
     102101707 (CHKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 444 aa AA seqDB search
MKTKFCNGDADPSPLGLILSRGSAAAGQPPSPLAHPEPEGKDPTAAGRGGGVSPLPPALP
PPLEEESPPLDPRTRRRAYLWCKEFLPGAWRGLQEEQLRISPIRGGLSNMLFQCSLPDTI
ETVADEPRKVLLRLYGAILQMRSCNKGESVQSQKENDLQGAEAMVLESVMFAILAERALG
PKLYGIFPQGRLEEFIPSRKLSTEELSLPDISAEIAEKMARFHGMKMPFNKEPKWLFGTM
EKYLNQVLRIKFTRESQTRKLNKLLSYNLPQEMKNLRAMLEATFSPVVFCHNDCQEGNIL
LLEGRESSENQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYPFFKASVLKYPSKK
QQLHFLSSYLSAFHDGFENLSNEEKSKLEEEVLVEVNRFALASHFFWGLWSIIQAKISSI
EFGYLEYALSRFDAYFDQKRKLKV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagttctgcaacggcgatgccgacccgtccccgcttggactcatccttagc
cgcgggtccgccgcggctgggcagccgccctcgccgcttgctcaccccgaacctgaggga
aaggaccccaccgcggcgggcagaggcggtggcgtctcgcccctgcccccggcgctgcct
ccgccgctcgaggaggagtcgccgccgctcgacccccggacgcggcgccgggcgtatctg
tggtgcaaagagttcctgccgggggcctggcgggggctgcaggaggagcagctgcgcatc
agccccatcagaggtggcctcagcaacatgctgtttcagtgctcactacctgataccatt
gagacagttgcagatgaaccacggaaagttctcctgcgtttatacggtgcaatcctgcag
atgaggtcgtgtaataagggagagtctgtacagtctcagaaggaaaatgacttgcaaggg
gcagaagccatggttctggaaagtgttatgtttgccattcttgcagagagagcacttggg
ccaaagctgtatggaatcttcccacaagggcgactggaggaattcattcccagcaggaaa
ctgagcactgaagaactaagcttgcctgacatatctgctgaaatagctgagaagatggcc
agatttcatggcatgaaaatgccatttaataaggaacctaagtggctttttggaacaatg
gaaaagtatctaaatcaagtgctgagaattaaatttaccagagaatcccaaaccagaaaa
ctaaacaaacttctcagttacaatctccctcaggaaatgaaaaatctaagagcaatgctt
gaagctactttttcaccagttgtgttttgccacaatgattgtcaagagggtaatatctta
cttctggaaggcagagagagttcagaaaaccaaaagctgatgctcattgactttgaatac
agcagctataattaccgaggatttgacattggaaatcacttctgtgaatggatgtatgat
tactcgtatgagaaatacccattcttcaaagccagtgttcttaaatatccttcaaagaaa
caacagcttcatttcctctccagttacctgtctgcattccatgatggctttgaaaatctg
agcaatgaagagaagtccaaactagaagaagaagtgttggtagaagttaacagatttgcc
cttgcatcacacttcttctggggtctgtggtctattatacaagcaaagatctcatccatt
gagtttgggtacctggaatatgcgttatccagatttgatgcctactttgatcagaagaga
aagctgaaggtgtga

DBGET integrated database retrieval system