KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102102739Help
Entry
102102739         CDS       T02921                                 

Gene name
GAD2
Definition
glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa)
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    102102739 (GAD2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102102739 (GAD2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102102739 (GAD2)
   00430 Taurine and hypotaurine metabolism
    102102739 (GAD2)
Enzymes [BR:phi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102102739 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 586 aa AA seqDB search
MASPGSGFWPFGAEEGSAAAEAPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPVETGA
RAAAPGVAEPRPTCTCDKKPCGCQKADVNYAFLHSTDLLPTCNGEITTMSFLQDVVDILL
QYVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQTLEEILLNCRTTLKYAIKTGHPRYF
NQLSTGLDMVGLAADWLTSAANTNMFTYEIAPVFVLLEYVTLRKMREMVGWPGGCGDGIF
SPGGAISNMYAMLIARFKMFPEVKEKGMAAIPRLVAFTSEHSHFSVKKGAAALGIGTDSV
ILIRCDERGKMIPSDLERRIVEAKQKGFVPFLVSATAGTTVYGAFDPLIAIADICKKYKI
WMHVDGAWGGGLLMSRKHKWKLNGIERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCN
QMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAQIDKCLELAE
YLYNKIKNREGYEMVFDGKPQHTNVCFWYIPPSLRGMEDSEERTSRLMKVAPVIKARMME
YGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIDEIERLGQDL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggcaagccccggctccggcttctggcccttcggagccgaggagggctccgcagccgcc
gaggctcccggcacagccagagcttggtgtcaggttgcgcagaagttcacgggagggatc
ggaaacaaactctgcgccctgctctacggtgatgccgagaagcccgtggaaaccggcgcc
agggcagcagccccgggggtagcggagccaaggccgacctgcacctgcgacaaaaaaccc
tgcggttgccaaaaagcggacgtgaattacgcctttctgcactcaacagatcttctgcca
acatgcaatggagaaataactactatgtctttcttacaagacgttgtggacattttactt
cagtatgtggtgaaaagtttcgatagatcaacaaaagttattgatttccattacccaaat
gagctgctccaggaatataactgggagctggcagaccagccacagaccttggaagaaatt
ttattgaactgcagaacaactctgaagtatgcaattaaaacagggcaccctagatatttt
aatcaactttcaactggattggacatggttggattggcggcagactggctaacatcagca
gcaaatactaatatgttcacctatgaaattgctccagtgtttgtacttttggaatatgtc
acactaaggaaaatgagagagatggttggctggccagggggctgtggcgatgggatattt
tcacctggtggtgccatatctaacatgtatgctatgttgattgcacgtttcaagatgttc
ccagaagttaaagaaaaaggaatggcagctattcccagactggttgccttcacatcagaa
catagtcacttttctgtgaagaaaggagctgcggctttgggtattggtacagatagtgtg
attttgattagatgtgatgaaagagggaaaatgatcccatcagaccttgaaagaagaatt
gttgaagccaaacagaaaggatttgttccttttctggtgagtgccacagctgggacaaca
gtgtatggggcgtttgatcctctcatagctattgcagacatctgcaagaagtacaaaatc
tggatgcacgtggatggagcatggggtggtgggctcctgatgtcgaggaaacacaaatgg
aagttaaatggcatcgaaagagctaactcagtaacctggaaccctcacaagatgatgggc
gtcccactgcagtgttcagccctgctagtaagagaagagggattgatgcagagttgcaat
caaatgcatgcttcctacctctttcaacaagacaagcactacgacctgtcttacgacaca
ggagacaaggctttgcagtgtggacggcatgttgatgtcttcaagctatggctgatgtgg
agggcaaagggaaccacaggatttgaagcacaaattgataagtgcttggaacttgctgaa
tacctatacaataaaataaagaacagagaagggtatgaaatggtatttgatggaaagcct
cagcacacaaatgtctgcttctggtacatacctcccagcttgcgtggaatggaggacagc
gaagagagaacgagccgcctgatgaaggtggcaccagtgataaaagccaggatgatggag
tatggcacaaccatggtgagctatcagcccctgggagacaaagtgaacttcttccggatg
gtcatctccaaccctgcagccactcaccaagacattgatttcctgattgatgaaatagag
cgcctgggacaagatttataa

DBGET integrated database retrieval system