KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102103580Help
Entry
102103580         CDS       T02921                                 

Gene name
RBKS
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    102103580 (RBKS)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     102103580 (RBKS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 375 aa AA seqDB search
MLDQVTRCGRFQPYPFWDSETLKGGGCARVMSTANSTLKEKCGNGERFERVACRSFDHLS
VTGERRGEAWSLMCVNIALNWNSLTTRLPKAGETILGHKFFVGFGGKGANQCVQSARLGA
KTSLICKVGNDSFGNDYVDNLKKNGISTAFVGQTTDAATGTASIIVNSEGQNVIVIVPGA
NLLLNFEDLKRASDVICKAKVVVCQLEVTPAVSLEALKMARASGVKTLFNPAPALADLDP
QFYTYSDIFCCNETEAEILTGIPVGNLEDAKKVGCMLLERGCKFVIVTLGAEGCMMISED
EPIAKHVPAGKVRAVDTTGAGDSFVGALAFYLAYYPKLSMEEMIRKSNCVASVSIQALGT
QSSYPYRKDLPQDLF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgttggaccaagtgacccgctgtggtcgtttccaaccttatccattctgggattctgag
actctgaaggggggcggctgcgcccgggtgatgtcgactgcaaacagtactttgaaagaa
aagtgtgggaacggggagaggtttgaacgtgttgcgtgccggagctttgatcatctgtct
gtgactggagagaggagaggagaggcttggtcactaatgtgtgtaaatattgctttaaat
tggaatagccttactacgcgattgccaaaagctggagaaactatccttggacataagttt
tttgttggttttggtgggaaaggagccaatcagtgtgtccagtctgctcgacttggggcc
aagacctcgctgatctgcaaggttgggaatgattcatttggcaatgattatgttgataat
ttgaagaagaatggcatttctacagcatttgtaggtcaaactacagatgctgccactgga
actgcttcaataattgtcaacagtgaaggacagaatgttattgtcatagtcccaggagcc
aatctgcttttaaattttgaagacctgaagagggcttctgatgtcatctgtaaagccaaa
gtggttgtttgccagctagaagtaacccctgctgtttctcttgaagctctgaaaatggca
cgtgccagtggagtaaagactttgtttaatccagctccagccctggctgacctagatcca
cagttttatacctattctgatatcttctgctgcaatgaaactgaggcagaaattttaacg
ggtatcccagttggcaaccttgaagatgctaaaaaggtgggatgcatgctgttagaaaga
gggtgtaagtttgtaattgtgactcttggagcagaaggctgcatgatgatatcagaagac
gaacccattgcaaagcacgttcctgctgggaaggtcagagctgtggacactacgggcgct
ggagacagttttgttggagcactggccttctacctggcctactatcccaagttatccatg
gaggaaatgatcaggaagtctaactgtgtcgcatcagtgagcatccaggcactggggaca
caatcttcatatccttacaggaaggacttgcctcaggaccttttctaa

DBGET integrated database retrieval system