KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102103600Help
Entry
102103600         CDS       T02921                                 

Gene name
KAT6B
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102103600 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2023 aa AA seqDB search
MVKLANPLYTEWILEAIQKVKKQKQRPSEERICHAVCASHGLDKKTVSEQLELSVQDGSI
LKVTNKGLASYKDPDNPGRFSCVKPGTIPKSVKGSRGACNELRNVDWNKLLRRAIEGLQE
PNGSSLKNIEKYLRSQNDLASIFNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLE
SKGAPKYSSTFPASLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIRRRYAKPIGRPKNKLKQRMLSVTSDE
GSVNAFTGRGSPGRGQKTKVCTTPSSGHAASVKDSSSRLPVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSLVLA
TGTTQKLKPPPSSLLPPIPISGQSPSSQKSSTSTSSNTPQSSSSQSSIPSFSSLPSSSQL
KGLFDGLSHIYTTQEQSRKKDHPSYAPHKHLCSKPELSSTSTSNSHFYGKNRVRSRFMSH
ACASGWGVSRGHAFKAIAHLKRTAFFKKHRILGRLKYKMTPQMGTPSPGKGSLTDGRIKP
DQDDDTEIKLSIKQENTDVFLLGSKDTVTQEDLEVFKQARELSLEKIGCKNTGETSGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSEKCGWFHPPANE
IYRRNDLSVFEVDGNVSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLV
GYFSKEKLCQQKYNVSCIMIMPQYQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLNCHHEKQISIKGMSRATGMCPHDIATTLQQHSMIDKREDRFVIIRR
EKLISSHMEKLKANPRINEVDPESLRWTPLLVSNAAVSEEEREAEKEAERLMEQASCWEK
EEQEIFSTRTNSRQSPAKVQSKNKYLRSSESVAVVGDRGQSTEQSKESSEEDGGDENQQS
SPPRLTKPQSLAIKRKRPFILKKKRGRKRRRINSSVTTETISETTEVLNEPFDNSDEERP
MPQLEPTCEMDGEDDDLKPVIRKAFEYQPGQQKQEEEQNKEEKDIHCYRSDENCTDNTED
VAVLEESTKDNLEPLQSKQGWPKGVKRGPSKWRQGKERKPGFKLNLYTPPETPMEPDYQV
LVEEQKEVAEDKPCSVPAVMEEAIKEPIEALAPPDDEVKEVEPEPLHPPSEPFEKQENDT
MKAGEEERSIEEDGINSKDQEKDKTEEVFVQKEESMHLDDQEEEEEEDEEPSHNEDHDAD
DEDDSHMGSTEVEKEELPGEAFKEMLETQQPFLDVNVQTGNSNQEELMDCGVDLAGDECE
SDQKELATDSDPVPESDDDHADNNQDQKAGEELHSDFKGENTETMEIDSETVQAVQSLTQ
ETSEHEDTFQDCAETQEACRSLQNYAHNDQSPQMTTLDDCQQSDHSSPVSSVHSHPSQSV
RSVNSPNVAPLENSYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDLG
SIESTTENYENPSSYDSTMGSSICGNNSSQNSCSYSSLTSSNLTQSSCAVTQQMSNINGS
CSMMQQANINSPPTCNVKSPQGCVVERPPSSNQQLSQCSMAANFTPPMQLTEIPETSNAN
IGLYERMGQSEFGAGHYSQPSATFSLAKLQQLTNTLMDHSLPYSHSAAVTSYANSASLSA
PLSNTGLVQLSQSPHAVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMTSSNIGISHTQ
RLQTQMASKGHVSVRTKSTPLPPAAAAHQPQIYGRASQTVAMQGPARTLTMQRGMNMSVN
LMPAPAYNVNSVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGT
QPYAQQPMQTAPHSNMMYTPPGHHGYMNTGMSKQSLNGSYMRR
NT seq 6072 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgccaaccctctttatacggagtggattctggaagctatacaaaaagtt
aaaaagcaaaagcaaaggccttctgaagagagaatatgtcatgctgtttgtgcttcccat
ggattagataagaagactgtttcagaacagttggaacttagcgttcaagatggttctatt
cttaaagtcactaacaaaggtcttgcatcttacaaggacccagataatcctggacggttt
tcatgtgttaaacctggcactattcctaaatctgttaagggatctagaggagcttgtaat
gagcttcgtaatgtggattggaataaactcttgagaagagcaattgaagggcttcaagaa
cctaatggctcctccctgaaaaacatagagaagtatttgagaagtcaaaatgacctagca
agtattttcaacaatcctgcctttcagcagaggttgcggctgggggccaaacgtgctgtg
aacaatgggaggttactgaaggatggtcctcagtatagagtgaattatggcagtttggaa
agcaaaggagctccaaaatactccagcaccttcccagcttcccttccacctgtcagccta
ttaccccatgaaaaagaccagccacgagctgatcccatcccgatatgtagcttttgcttg
ggaacaaaagaatcaaatcgtgaaaaaaagccagaagagctcttgtcttgtgcagattgt
ggcagcagtggacatccatcatgtttgaaattctgtcctgagttaacaacaaatgtgaag
gccttgaggtggcagtgtattgaatgcaagacatgcagtgcgtgtaggatccaaggcaaa
aatgcagataacatgcttttttgcgactcctgtgatagagggttccacatggaatgctgt
gacccaccactatcccgaatgccaaaagggatgtggatttgccaggtctgtagaccaaag
aagaaagggagaaagctgcttcatgagaaggctgcgcaaataaggagacgatatgcaaaa
cctattggacgaccgaaaaataaattaaagcaacgaatgttgtctgtaaccagtgatgaa
ggatccgtgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgtgaaggattcaagcagcagattgcct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacata
tctgcctctacacttaaagttaacaagaaaaccaaaggtctcattgatggccttactaag
ttctttacaccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcttgtgttggct
acaggtaccacacaaaagctaaaacctccaccttcttcacttctacccccaatccccatc
tctggtcagagccccagttctcaaaaatccagcacttccacttcttctaacactccccaa
agttcttccagtcagtcaagcataccctcctttagtagccttcctagtagcagtcagcta
aagggactctttgatggactctctcatatctataccactcaggaacagtctcgaaaaaag
gatcacccaagctatgcaccccacaagcatttgtgtagtaaaccagaattatcttccaca
tcaacatctaatagtcatttctatggaaagaacagggttaggagtaggtttatgtctcat
gcctgtgcctctggatggggtgtgtctagaggacatgcttttaaagcaattgctcacctc
aagagaacagctttctttaaaaagcacaggattctaggcagattaaagtataaaatgacc
cctcagatggggaccccctcaccagggaaggggagcttgacagacggaaggattaaacct
gatcaggatgatgatactgaaatcaaactaagcatcaaacaagaaaatacggatgtattt
ctgttgggaagcaaggacactgttacacaggaggatttggaagtctttaagcaggctcga
gaactttccctggagaaaattgggtgtaaaaacactggtgaaacaagtgggcgataccct
tcagtgattgagtttggaaaatatgagatccagacctggtactcttcaccttacccacag
gaatatgcaagattgccaaagctttacctgtgtgagttctgtcttaaatacatgaaaagt
aaaaacattttgttaaggcactcagagaaatgtggctggtttcatcctccagccaatgaa
atctacagaagaaatgacctttcagtatttgaggttgatggaaatgtgagcaaaatttat
tgtcagaatctttgtttgttagctaagctctttctggaccacaaaaccttgtattatgat
gttgaaccattcctcttctatgtccttacaaaaaatgatgagaaaggctgccatttagtt
ggatatttctctaaggaaaagctttgccagcagaagtacaatgtctcctgcataatgatc
atgccccaataccaaaggcaaggatttggaaggtttctcattgatttcagttatttgctt
tctagaagagagggtcaagcaggatcccctgaaaagccattgtctgatctgggtcgcctc
tcatacttggcttattggaaaagtgtcatattggaatacctgaactgccaccatgaaaag
caaatcagtatcaaaggaatgagccgagctactggaatgtgtcctcatgatattgccaca
accctgcagcaacatagcatgatagataaaagagaagatagatttgtaattattagaagg
gaaaagctgatttcaagtcatatggagaagctgaaagcaaatccacgtatcaatgaagta
gatcccgaaagcttgagatggactcctttgttagtttctaatgctgcagtttctgaagaa
gagagggaagcagaaaaggaggctgagcgtcttatggaacaagctagctgctgggaaaag
gaagagcaagaaatattctccacaagaactaatagtaggcaatcacctgcaaaagtacaa
tctaaaaataaatatttgcgatcttcagaaagtgtggcagtggtgggggaccgagggcaa
tccacagaacaatctaaagaaagcagtgaggaggatggtggggatgagaatcaacagagt
tcacctccccggctgacaaagccccagtccctggccataaaaagaaagagacctttcata
ctgaaaaagaaaaggggccgtaaacgcaggaggataaatagcagtgttacaacggagaca
atttctgaaacaacagaggtgttgaatgagccatttgataactcagatgaagagcgtccc
atgccacagctggaacccacctgtgagatggatggagaagatgatgacttgaagcctgtg
attcgaaaagcttttgagtatcagcctgggcagcagaaacaggaggaagagcagaacaag
gaggagaaagatattcattgttaccggagtgatgaaaattgtacagataatacagaggat
gtagctgtgttggaagaaagcactaaagacaatcttgaacctttacagagtaagcagggt
tggcccaaaggagttaaacgtggtccatctaaatggaggcaaggcaaagaaagaaaacct
ggctttaagcttaatttatacactccacctgagactcccatggagcctgactatcaggtg
ctggtggaagaacagaaggaagtagctgaagacaagccctgttcagttcctgctgttatg
gaggaagctattaaagaacctattgaagcattagcaccaccagatgatgaggtgaaagaa
gtagaacctgaacctctgcatccacccagtgaaccctttgaaaaacaagaaaatgatact
atgaaagctggggaagaagaaaggagcatagaggaagatggaatcaattcaaaagatcaa
gaaaaagacaaaacagaagaagtttttgtgcagaaagaggagtccatgcatttggatgat
caggaggaagaggaggaggaggatgaagaaccttctcacaatgaggatcatgatgcagat
gatgaagatgatagtcacatgggttcaacagaagtggagaaagaggaattacctggtgaa
gctttcaaggaaatgctggaaactcagcaaccttttttagacgtaaatgttcaaactggt
aattcaaatcaggaggagttaatggattgtggtgttgaccttgcaggtgatgaatgtgaa
agtgaccagaaggaacttgctacggattcagacccagtgcctgaatctgatgatgatcat
gcagacaacaaccaggaccaaaaagctggtgaagaattacattccgatttcaagggagag
aatactgagaccatggagattgactcagagacagttcaggcagtacagtctctaacccaa
gaaacaagtgaacacgaagatacatttcaggactgtgcagagactcaagaggcctgtaga
agtttgcagaactatgcccacaatgaccaaagtccccaaatgaccacactggatgactgt
cagcagtctgaccacagcagcccagtttcatctgtgcactctcatcccagccagtcagtt
cgttctgttaatagtccaaatgttgctcctttagagaacagctatgctcagatcagccca
gatcaaagtgccatttctgtgccgtctctccagaacatggagaccagcccaatgatggat
gttccctcagtttctgatcattcgcagcaagttgtggatagtgggtttagtgacttagga
agtattgagagcacaacagaaaactatgaaaacccaagcagttacgattctacaatgggt
agtagtatctgtggaaacaactcttctcaaaacagttgctcctacagcagccttacatct
agtaacctaacacagagtagctgtgcagtgacccagcagatgtctaacattaatggaagc
tgcagtatgatgcaacaagcaaacatcaattctcctcccacttgtaatgtaaaatctccc
caaggttgtgttgttgaaaggcctccaagcagcaaccaacagttatcccagtgcagcatg
gctgctaatttcacaccacctatgcagttgactgaaatccccgagactagcaatgccaac
attgggttatatgaaagaatggggcagagtgaattcggagcagggcattactcacagcca
tctgccaccttcagccttgctaaactgcagcagttaactaatacgcttatggatcattct
ttgccttacagccattcagctgctgtaacttcctatgcaaacagtgcctctttgtctgcc
cccttaagtaacacagggcttgttcagctttctcagtctccacatgctgttcctggagga
ccccaagcacaggctaccatgacccctccccccaaccttactcctcctcccatgaatttg
ccgcctccccttttgcagcgtaatatgacttcatcgaatattggaatatcccacacccaa
agactgcagactcagatggccagcaaaggtcacgtctctgtaagaaccaaatccacgcct
ctgccacctgctgctgcagcccatcagccacaaatttatgggcgagcttcacagactgtg
gccatgcaagggcctgcacggaccttaacaatgcagcgtggcatgaacatgagtgtaaat
ttgatgccagcccctgcttataatgtcaattcagtgaacatgaatatgaatacccttaat
gctatgaatggttacagtatgtcccagccaatgatgaatagtggctatcacagtaatcat
gggtatatgaatcaaaccccccagtaccctatgcagatgcagatgggaatgatgggaact
cagccatatgcacagcagccaatgcagacagcaccccacagtaacatgatgtacactcct
ccgggccaccacggctacatgaacacaggcatgtccaaacagtctctcaatggatcctac
atgagaaggtag

DBGET integrated database retrieval system