KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102103816Help
Entry
102103816         CDS       T02921                                 

Gene name
ABHD12B
Definition
(RefSeq) abhydrolase domain containing 12B
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102103816 (ABHD12B)
Peptidases [BR:phi01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102103816 (ABHD12B)
Exosome [BR:phi04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102103816 (ABHD12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 376 aa AA seqDB search
GRVSVTWAWSVGAVGRAAMRRRGGDGDGGDSGDIGRAEGRSGAARQGRAQHSWLPGLRTL
LLAPLLTYTSLPFLIRLFPSVLTKFVYLNFLAFPFFVDFRRPEVLVTNTINLQLSTEPGV
TVGVWHTVPGSRGAEARGKDQRWYEEALADAHPVIIYLHGNGGTRAASHRVQFLKTMGAA
DFHILALDYRGYGDSTGHPSERGFTTDVLALYDWAKARSGNSSILFWGHSLGTGIATNAA
RKLQEERGVQVDAVVLESPYTNIRDAAANIPITKIYRQFPGFESLILDSLARAGMFFHSD
ENVKVLGCPLLILHAEDDGVLPPKLGRKLYETAHKAYKDKSKVKFITFPEKLGLGHDYIS
FNPELPALVRDFLNMK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gggcgtgtctccgtgacgtgggcgtggtctgtcggcgctgtcgggcgcgcagcgatgcgg
cgtcgcggcggggacggcgacggtggcgacagcggcgacattgggagggcggagggcagg
tccggcgcggcccggcagggacgggctcagcactcctggctcccagggctgcgcaccctc
ctcctggccccgctgctcacctacacctccttgcccttcctcatccgcctcttccccagc
gtgctcaccaaatttgtctacctgaacttcctggccttccccttcttcgtggactttcgg
cggccggaggtgctggtgaccaacaccatcaacctgcagctcagcacggagccgggtgtc
acagtcggtgtctggcacacggtgccgggcagcagaggggccgaggcgcggggcaaggac
cagcgctggtacgaggaggctcttgctgatgctcaccccgtgatcatctacctgcacggc
aatgggggcaccagggctgcgagtcaccgtgtccagttcttgaagacgatgggggctgct
gactttcacatcctggctctcgactacagaggctatggggactccactggacacccctca
gagagaggcttcaccacggatgtcctggcgctctatgactgggcgaaagcgcggagtggg
aacagcagcatcctcttctggggacattccctggggacagggattgccaccaacgcagcg
aggaaactgcaggaggagcgaggggtccaggttgatgccgtggtgctggagtctccctac
accaacatccgagacgcagccgccaacatccccatcaccaagatctaccggcagttcccg
ggtttcgagtccctcatcctggactccctggctcgggcaggaatgttcttccacagtgat
gagaatgtgaaggtgctgggctgccccctcctcatcctgcacgcagaagatgacggagtc
ctgcctccaaagctgggacgcaagctctatgagacagcacacaaagcctacaaggacaaa
tccaaggtgaagttcattacctttcccgaaaagctgggcttgggccacgactacatctcc
ttcaacccagagctgcctgccctggtgagagacttcttaaacatgaagtga

DBGET integrated database retrieval system