KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102104611Help
Entry
102104611         CDS       T02921                                 

Gene name
PPOX
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    102104611 (PPOX)
Enzymes [BR:phi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     102104611 (PPOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 458 aa AA seqDB search
MPPTVAVVGGGISGLAACYHLVRAPRPPKVVLLEASGRFGGWLQSSRTPEGAVFEHGPRG
VRPAGAAGAETLHMVSELGLAGDILAVPGDHPASRNRFLYRGGTLHPLPSGLGGLLRAVP
PFSRALLWSAVRDLLTPPGTEPDESAHAFAQRRFGPEVAELAVDSLCRGVFAGDSRALSV
RSCFPALFQAERQRGSVLLGLALPHGGRGAAPAPALARRARAERWSQWSLRGGMESLARA
LVAFVSPRGAELRCHAPLTHLRRHRGRWQLTLPDSTVTADHVISALPAAALARALPADAE
PLARELGAISAASVAVVNLQYRGVALPVTGFGHLVPSSEDPALLGIVYDSVAFPEHDGTP
GGVMLGGSWFRQSFGEPSAAPPELLLSRARAAARDHLGLPGTPTRAILRVQQEQALPLSL
VGASYGGVSVNDCIASARAAVGRILGSPPDPPAPNPPA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaccgtggccgtcgtgggcggcggcatcagcggcctggccgcctgttaccac
ctggtgcgcgccccccgcccgcccaaggtggtgctgctggaggccagcggccgtttcggg
gggtggctgcagagcagcaggacccccgagggggccgtgttcgagcacggcccgaggggc
gtccggccggccggggccgcgggggccgagaccctgcacatggtgtcggagctggggctg
gccggtgacatcctggctgtccctggggaccacccggcgtcccggaaccgcttcctgtac
cggggggggaccctgcacccactgccctcggggctggggggtttgctgcgggcggtgccg
ccgttctctcgggctctgctctggagcgctgtgcgggacctgctgaccccgccgggcacg
gagccggacgagagcgcccacgccttcgcccagcgccgcttcggccccgaggtggccgag
ctggctgtggacagtctgtgccggggggtgtttgccggggacagccgagccctgagcgtg
cgctcctgcttccccgcgctgttccaggccgagagacagcgcggatccgtcctgctgggg
ctggcactgccacacggcgggcgcggcgcggccccggcgccggcgctggcgcggcgggcg
agggcggagcgctggagccagtggtccctgcgcgggggcatggagagcctggcacgggcc
ttggtggccttcgtgtcaccgcgcggcgccgagctgcgctgccacgcgcccctgacacac
ctcaggcgtcaccgcggccgctggcagctgaccctgccggacagcaccgtcacagccgat
cacgtgatcagcgcgctcccggccgcagcgctggcccgggcgctgccggccgatgcggag
ccgctggctcgggagctcggggccatctcggccgcctcggtggccgtggtcaacctgcag
taccggggggtggcactgcccgtcacgggttttggtcacctggtgccatcctcggaggac
ccggcgctcttgggcatcgtctacgactcggtggcgttcccggagcacgacgggaccccc
gggggggtgatgctgggcggctcctggttccggcagagttttggggagccgtcggcggcg
cccccggagctgctgctgagccgagcccgggcggccgctcgggaccacctggggctgccc
gggacccccacccgcgccatcctcagggtgcagcaggagcaggcgctgcccctcagcctg
gtgggcgcctcctacggcggcgtctcggtcaacgactgcatcgccagcgccagggcggcc
gtggggcgcattttggggtccccccccgaccccccagccccgaatccaccggcgtaa

DBGET integrated database retrieval system