KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102105522Help
Entry
102105522         CDS       T02921                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2 (liver)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102105522 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102105522 (GYS2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    102105522 (GYS2)
Enzymes [BR:phi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102105522 (GYS2)
Glycosyltransferases [BR:phi01003]
 Polysaccharide
  Storage polysaccharide
   102105522 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 704 aa AA seqDB search
MPLARSLSMTSLNGLPQCEDEDMPVEDLLLFEISWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLIGPYFEQNVKTQVEFSEPPNPAVKKAMDTMKSQGCQVFFGRWLIEGSPYVLLFDI
GSAAWNLDKWKGEFWEVSNIGIPFQDREANDAVIFGSLTAWFLKELSCQFDEKPNVIAHF
HEWQAGVGLILSRSQKLPVATIFTTHATLLGRYLCAASIDFYNNLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITATEAEHMLKKSPDVVTPNGLNIKKFSAMHEFQNLHSM
YKARIQEFIRGHFYGHLDFDLDKTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKTD
VTVIVFFIMPAKTNNFNVETLKGQAVRKQLWDTAQSVKEKFGRKLYNALLKGEIPDLNKI
LDRDDISIMKRAIFSTQRHSLPPVTTHNMIDDSNDPILNTIRRIGLFNNRTDRVKVILHP
EFLSSTSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPEAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQNRRQRIIQRNRTERLSDLLDWK
YLGRYYMHARHLALSRTFPDKFEMEPSAPPKTEGFRFPRPSSVPPSPSASQHSSPHHSEA
EDEDEDERYDEDEEAERDRQNIKSPFSLGALPQGKKKQHGEYRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccactggcgagatccttgtccatgacatctctgaatgggcttcctcagtgtgaggat
gaagacatgcccgtggaggatttgttgctctttgaaatttcctgggaagttaccaacaaa
gtgggaggcatttacactgtgatccagacaaaagccaaaactacagcagatgaatggggc
gaaaactatttcctgattggcccctattttgagcagaatgtgaagactcaggtggaattc
tctgaacctccaaaccctgcagttaagaaggcaatggacaccatgaaaagccaagggtgt
caggtcttttttggaagatggctgatagagggcagcccatatgtcttactgtttgatata
ggatcagcagcttggaacctggacaagtggaaaggtgaattttgggaagtcagcaacata
ggaatcccttttcaggaccgagaagccaacgatgctgtgatttttggatcattaacagcc
tggtttttgaaagagctttcctgtcagtttgatgagaagcccaatgtaattgcccatttc
catgagtggcaggcaggagtgggtttaatcctgtctcgatcacagaaactccctgtcgcc
acaatttttactacccatgcgactctgctagggagatacttgtgtgcagccagtattgac
ttttacaacaacctggaccagtttgacattgacaaggaggctggagagaggcagatttac
catcggtactgtatggagcgggcatctgtacactgtgcccacgtgttcaccacagtctct
cagatcacagctacagaagcagaacatatgcttaaaaaaagccctgatgttgtcacccca
aatggcttgaacattaagaaattttcagcaatgcatgagtttcagaatttgcattccatg
tacaaggctaggatccaagagttcattcgaggtcatttctatggccaccttgacttcgat
cttgacaagactttgtttttcttcattgctgggagatatgagttttccaacaaaggagct
gatatgtttctagaagccttatcaagattaaactttttgctgagggttcacaagactgat
gttacagttattgtgttcttcatcatgccagcaaagaccaacaatttcaatgtggaaacc
ttgaaaggacaagcagtccgtaagcagctctgggacactgcacaatctgtgaaagaaaag
tttggaagaaagctctacaatgccttgctgaaaggagaaatcccagacttgaacaagatt
cttgaccgagatgacataagcattatgaaaagagccatcttttcaactcagagacactct
ctgcctccagtgaccacccacaacatgattgatgacagcaatgacccaatcctcaacacc
atccggcgcattgggctgttcaacaaccgcacagaccgtgtgaaagtgatcctacatcca
gagtttctttcttcaacaagccccttgctgcccttggactatgaggagtttgttagaggc
tgccaccttggtgtattcccatcttactatgaaccctggggctacactccagctgagtgt
actgtgatgggcattcccagtgtaaccacaaacctctctggattcggctgtttcatgcag
gaacatgttgctgacccagaagcttacgggatctacatcgtggacaggaggttccgctcg
ccggacgagtcgtgcaaccagctgacccagttcctgtacgggttctgccagcagaaccgg
cgccagaggatcatccagaggaaccgcactgagcgcctctcggacctcctggactggaaa
tacctgggcaggtattacatgcatgccagacacttggccctcagcagaacgttcccagat
aaatttgagatggaaccaagtgctccaccaaagacggaaggtttcaggttccccaggcct
tcatcagtgccaccatcaccctctgcctcccagcattctagcccccaccacagtgaagcc
gaggacgaagatgaggatgagagatacgacgaggatgaggaagctgaaagggacaggcag
aacatcaagtcccccttttcccttggagccttgccacaaggaaaaaagaagcagcatgga
gaatacaggaactga

DBGET integrated database retrieval system