KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102105564Help
Entry
102105564         CDS       T02921                                 

Gene name
MAOA
Definition
(RefSeq) amine oxidase [flavin-containing] A
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00260  Glycine, serine and threonine metabolism
phi00330  Arginine and proline metabolism
phi00340  Histidine metabolism
phi00350  Tyrosine metabolism
phi00360  Phenylalanine metabolism
phi00380  Tryptophan metabolism
phi00982  Drug metabolism - cytochrome P450
phi01100  Metabolic pathways
Module
phi_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102105564 (MAOA)
   00330 Arginine and proline metabolism
    102105564 (MAOA)
   00340 Histidine metabolism
    102105564 (MAOA)
   00350 Tyrosine metabolism
    102105564 (MAOA)
   00360 Phenylalanine metabolism
    102105564 (MAOA)
   00380 Tryptophan metabolism
    102105564 (MAOA)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102105564 (MAOA)
Enzymes [BR:phi01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     102105564 (MAOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_3 FAD_binding_2 Thi4 FAD_oxidored Pyr_redox_2 HI0933_like Pyr_redox GIDA Pyr_redox_3 AlaDh_PNT_C Lycopene_cycl GDI MCRA Trp_halogenase TrkA_N
Motif
Other DBs
NCBI-GeneID: 102105564
NCBI-ProteinID: XP_014111193
Position
Un
AA seq 521 aa AA seqDB search
MAERYDVIVIGGGISGLSAAKLLSEAGVSVVVLEARDRVGGRTFTIRNDKVNYVDVGGSY
VGPTQNRILRLAKELGVETYKVYVEGHMFHHKGGKSRNFTGICPSTWNPLVYLDYNNFWR
TMDKMGKEIPADAPWDAPHAEEWDKMTMKELINKICWTKAVRDFATVFVNVNVTSEPHEV
SALWFLWYVRQCGGTSRIFSITNGGQERKFKGGSGQISEKIMERLKGRVKLERPVISIDQ
TGDNVLVETLNHEIYEGKYVISAIPPILTTKMHYKPELPPKRNQLIQRLPMGSVIKCMMY
YREAFWRRKGYCGSFIIEDEESPIGITIDDTKPDGTFPAIMGFILTRKAVKLAHLSKEER
KKKICEAYAKALGMKEALQPVHYEEKNWTMEQYSGGCYTAYFPPGIMHSYGRIIRQPVDR
IYFAGTETASQWSGYMEGAVQAGERAAREVLHSMGKISKSEIWMPEPESKDVPAQPFTTT
FWERNLPSAPGLLCLLSCTLCLTSVAAAGLFVCKKGLVARN
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggccgagagatacgacgtgatcgtgatcgggggcggcatctcaggtttgtcagctgcc
aaattgctgtctgaggctggggtcagtgtggtggtccttgaggcccgggacagagttgga
ggaaggacattcactatcaggaacgataaagtgaattatgtagatgttggtggatcttat
gtgggacctacccaaaaccggattctccgactggcaaaagagctgggggtggagacctat
aaagtgtatgtcgagggccatatgttccatcataaagggggaaagtcacgaaatttcaca
ggaatttgcccttcaacatggaatcccttggtttatctggattacaataacttctggaga
accatggacaagatgggaaaagagattcctgctgatgctccatgggatgctccacatgct
gaagaatgggacaaaatgaccatgaaagagctgataaataagatttgctggaccaaagct
gtcagagacttcgccacggtctttgtcaacgtcaacgtcacgtctgagcctcacgaagtc
tctgccctctggttcctgtggtatgtgaggcagtgtgggggcacatccaggattttctct
atcaccaatgggggccaggagaggaagtttaaagggggttctggtcagatatcagagaaa
ataatggaacgcctcaaaggcagagttaaactggagagacctgtgatcagtatcgaccag
acaggtgataatgtccttgtggagactctaaaccatgagatatatgagggcaagtacgtg
atcagtgccatccctccaatcctgacaacaaagatgcattacaaaccagagctgccacca
aagagaaaccagttaattcagcgtttgcctatggggagtgtcataaaatgcatgatgtac
tacagggaagccttctggaggaggaagggttactgtggttccttcatcattgaggatgaa
gagtctccaattggaataaccatagatgacacaaaacctgatggaacttttcctgccatt
atgggtttcatccttaccagaaaggctgtcaaactggcccatctcagcaaggaagagagg
aaaaagaagatctgtgaggcatatgccaaggcactggggatgaaagaggctttacaacct
gtgcattatgaagagaagaactggaccatggagcaatattcagggggctgctacacagcc
tacttcccaccaggcataatgcattcctatggcaggatcattcgccagcctgttgacaga
atctactttgctggcacggagacagcaagccagtggagcggatacatggagggggccgtg
caggcgggagagagagcagccagagaggtactgcacagtatggggaagatctccaagagt
gaaatttggatgccagagccggagtcaaaggatgtcccagcccaaccattcaccaccacc
ttctgggaaaggaacctgccctcggcgccggggctgctgtgcctgctgagctgcaccctg
tgtctcacctctgtggctgctgcggggctcttcgtctgtaaaaagggacttgtcgctcga
aactag

DBGET integrated database retrieval system