KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102106643Help
Entry
102106643         CDS       T02921                                 

Gene name
PIK3CB
Definition
phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Influenza A
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102106643 (PIK3CB)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    102106643 (PIK3CB)
   04370 VEGF signaling pathway
    102106643 (PIK3CB)
   04630 Jak-STAT signaling pathway
    102106643 (PIK3CB)
   04068 FoxO signaling pathway
    102106643 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    102106643 (PIK3CB)
   04150 mTOR signaling pathway
    102106643 (PIK3CB)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    102106643 (PIK3CB)
  Cell growth and death
   04210 Apoptosis
    102106643 (PIK3CB)
  Cell communication
   04510 Focal adhesion
    102106643 (PIK3CB)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    102106643 (PIK3CB)
  Endocrine system
   04910 Insulin signaling pathway
    102106643 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    102106643 (PIK3CB)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102106643 (PIK3CB)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    102106643 (PIK3CB)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102106643 (PIK3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1066 aa AA seqDB search
MPPAVTDSLDIWAVDSQIGADGSISVDFLLPTGIYINLDVPRDATISQIKQLLWKQAHSY
PLFHLLMEIDSYMFSCVNQTAVHEELEDETRRLCDVRPFLPVLKLVTRNCDPGEKLDSRI
GVLIGKGLHEFDALQDPEVNDFRAKMRRISEEKIQSLVGLSWMDWLKHTYPPEQEPVIPE
SFQDKLYSGNLVVAVHFDNCQDVFSFQVSPNMNPIKLNELAIRKRLTIHGKEDEEVDPAD
YVLQVSGRLEYVFGDHPLIQFQYIRNCVMSRTLPQLTLVECCTIKKMCEQEMIAIEAAIN
RKSSNLPLPLPPKKTRATTSVWDISNPFKIILLKGNKLNTEENAKVHVRAGLFHGTELLC
KTIVSTEISGRSDHIWNEVLEFEINVCDLPRMARLCFAVYAVMDKMKTKKSTKAMNPSKY
QTIRKAGKVHYPVAWVNTMVFDYKGHLRIGELVLHSWSSFPDELEEMLNPMGTVQTNPYT
ENATALHIRFQEYSKQPINYPPFDKILEKAAEIARNSDNAAMAGRGGKKFYVVLKDIMER
DPLSQLCENEMDLIWTLRYDCRENFPQSLPKLLLSLKWNKLEDVAQLQALLQIWPKLLPR
EALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERA
LGNRRIGQMLFWHLRSEVHIPAVSVQFGLILEAYCRGSVAHMKVLAKQVEALNKMKTLNS
LIKLNAMKQSKAKGKDAMHTCLKQNAYREALSDLQSPLNPSVILSELHVEKCRYMDSKMK
PLWIVYNNKMFGGDLVGIIFKNGDDLRQDMLTLQILRLMDILWKEAGLDLRILPYGCLAT
GDHSGLIEAVSSSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNLGEDLDRAIEEFTLS
CAGYCVATYVLGIGDRHSDNIMVRKNGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDF
IHVIQQGKTGNTEKFGRFRQYCEEAYLILRKHGNLFITLFALMLTAGLPELTSVKDIQYL
KDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctgccgtgacagacagccttgacatctgggcagtggattcacagattggtgct
gatggctcaatatctgtggacttcctgttgcccactggaatctacatcaacctggacgtc
cctcgagatgccaccatatctcagattaaacagctgttatggaagcaggcacattcctac
cctctctttcatctcctcatggagattgactcttacatgttctcatgtgtgaatcagact
gctgtgcatgaagaattagaggatgaaacacggagactttgtgatgttagaccctttctt
cctgtccttaaactagtgacaaggaactgtgatccaggagaaaagttggattccagaata
ggtgtccttataggcaaaggtctccatgagttcgatgccttacaagatcctgaagtgaat
gacttccgagctaaaatgaggagaatcagtgaagaaaagattcaatctcttgtgggtctc
tcctggatggactggttgaagcacacttacccaccagagcaggagcctgttatcccagag
agcttccaagataaactctacagtgggaaccttgtagtggctgttcattttgacaattgc
caggatgtatttagtttccaggtgtctcctaacatgaatcccatcaagctgaatgaactg
gcaatccgaaaacgtttgactatccatggaaaagaagatgaggaagttgatcctgctgat
tatgtgctgcaagttagtggaagactggaatatgtctttggtgatcacccattaattcag
ttccagtatatccgcaactgtgtgatgagcaggacccttccccagctgacactggtggag
tgctgcaccataaagaagatgtgtgagcaggagatgattgccatagaagctgccataaac
cgaaaatcctccaacctccctcttcctctgccaccaaaaaaaacaagagcaacaactagt
gtgtgggatatttctaacccattcaagattattctattaaagggtaataaactaaacaca
gaagaaaatgccaaagttcatgttagggctggtcttttccatggcacagagctcctttgt
aaaacaattgtaagcacagaaatatctgggagaagtgaccacatttggaatgaagtgctg
gagtttgaaatcaatgtctgtgatctgccaaggatggcaaggctctgctttgctgtttat
gctgtcatggataagatgaaaactaaaaagtctaccaaggcaatgaatccttccaaatac
caaaccattaggaaagcaggaaaagtgcattatcctgtagcctgggtaaataccatggtg
tttgattataaaggacacttgaggattggagaactggtactgcacagctggtcatcattt
cctgacgaacttgaagaaatgttgaatcccatgggaaccgtccagaccaacccttacact
gagaatgcaacagctttgcacattagatttcaggaatattcaaaacagcctattaattac
cctccctttgataagatacttgaaaaggcagctgagattgcaagaaacagtgacaatgct
gcaatggcgggtcgaggtggtaagaagttttatgttgtgctaaaagatataatggaaaga
gatcctttatctcagctttgtgaaaatgaaatggatctcatttggactttgcgatatgac
tgtcgtgaaaatttcccacaatcgttgccaaaactgctgctctctttaaagtggaacaaa
cttgaagacgttgctcagcttcaggccctcctgcagatctggcccaagctgctgcccagg
gaggctttggagctgctggatttcaattatcctgaccagtacgtcagggaatatgcagtg
gggtgtttgaggcagatgagtgatgaagagctctctcagtatcttctccagcttgtgcaa
gtcctgaagtatgagccttttctggattgtgcactctccaggtttctcttggaaagagca
cttggaaacaggagaataggacagatgttgttctggcacctgaggtcggaggttcacatc
cccgccgtgtcggtgcagtttggtttgattctggaggcttattgcagggggagcgtggct
catatgaaggtgctagctaaacaggtggaagccctcaataaaatgaagactttaaatagt
ctaattaagctgaatgccatgaagcaaagcaaagcaaaaggcaaagatgcaatgcatacg
tgtttgaaacaaaatgcttacagagaagcactttctgacctccagtctcctctgaatcct
tctgttatactctcagagctgcatgttgagaagtgtagatacatggattctaaaatgaag
ccgctctggatagtgtacaacaacaaaatgtttggaggagatcttgtagggatcatcttt
aagaatggtgatgatctccggcaggacatgttgacgctccagattctgcgcttgatggac
attctgtggaaagaggctggcctggatctccggatattgccctatggctgtttagcaact
ggagatcactctggcctcattgaggctgtttctagttcagaaaccattgctgacattcag
ttaaacagcagcaacgttgctgcagctgctgccttcaacaaggatgcgctcttgaactgg
ctgaaggaatacaatttaggagaggacttggatcgagccattgaagaatttactctgtcc
tgtgctggctactgtgtagctacgtatgtgctgggaattggtgacagacacagcgacaat
atcatggtcaggaaaaatgggcagctgtttcacatagattttgggcatattcttggaaac
tttaagtccaagtttggaattaaaagggaacgggtacctttcatactcacctatgatttc
attcatgttattcaacaaggaaaaacagggaacactgaaaaatttggccggttccggcag
tactgtgaggaagcctacctgatcctgcgcaagcacggcaacctatttattaccctcttt
gcactgatgctgactgcagggctgccagagctcacctctgtcaaggacatccagtatctc
aaggactcccttgccctagggaagagtgaggaagaagcactaaaacagttcaagcaaaag
tttgatgaagctctgcgggaaagttggactactaaagtgaactggatggctcacactgtc
agaaaagattacaggtcctag

DBGET integrated database retrieval system