KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102106643Help
Entry
102106643         CDS       T02921                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00562  Inositol phosphate metabolism
phi04012  ErbB signaling pathway
phi04068  FoxO signaling pathway
phi04070  Phosphatidylinositol signaling system
phi04140  Autophagy - animal
phi04150  mTOR signaling pathway
phi04210  Apoptosis
phi04218  Cellular senescence
phi04370  VEGF signaling pathway
phi04510  Focal adhesion
phi04620  Toll-like receptor signaling pathway
phi04625  C-type lectin receptor signaling pathway
phi04810  Regulation of actin cytoskeleton
phi04910  Insulin signaling pathway
phi04914  Progesterone-mediated oocyte maturation
phi04933  AGE-RAGE signaling pathway in diabetic complications
phi05164  Influenza A
Module
phi_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102106643 (PIK3CB)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    102106643 (PIK3CB)
   04370 VEGF signaling pathway
    102106643 (PIK3CB)
   04068 FoxO signaling pathway
    102106643 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    102106643 (PIK3CB)
   04150 mTOR signaling pathway
    102106643 (PIK3CB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    102106643 (PIK3CB)
  Cell growth and death
   04210 Apoptosis
    102106643 (PIK3CB)
   04218 Cellular senescence
    102106643 (PIK3CB)
  Cellular community - eukaryotes
   04510 Focal adhesion
    102106643 (PIK3CB)
  Cell motility
   04810 Regulation of actin cytoskeleton
    102106643 (PIK3CB)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    102106643 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    102106643 (PIK3CB)
  Endocrine system
   04910 Insulin signaling pathway
    102106643 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    102106643 (PIK3CB)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    102106643 (PIK3CB)
  Infectious diseases
   05164 Influenza A
    102106643 (PIK3CB)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102106643 (PIK3CB)
Membrane trafficking [BR:phi04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102106643 (PIK3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 102106643
NCBI-ProteinID: XP_005529658
Position
Un
AA seq 1066 aa AA seqDB search
MPPAVTDSLDIWAVDSQIGADGSISVDFLLPTGIYINLDVPRDATISQIKQLLWKQAHSY
PLFHLLMEIDSYMFSCVNQTAVHEELEDETRRLCDVRPFLPVLKLVTRNCDPGEKLDSRI
GVLIGKGLHEFDALQDPEVNDFRAKMRRISEEKIQSLVGLSWMDWLKHTYPPEQEPVIPE
SFQDKLYSGNLVVAVHFDNCQDVFSFQVSPNMNPIKLNELAIRKRLTIHGKEDEEVDPAD
YVLQVSGRLEYVFGDHPLIQFQYIRNCVMSRTLPQLTLVECCTIKKMCEQEMIAIEAAIN
RKSSNLPLPLPPKKTRATTSVWDISNPFKIILLKGNKLNTEENAKVHVRAGLFHGTELLC
KTIVSTEISGRSDHIWNEVLEFEINVCDLPRMARLCFAVYAVMDKMKTKKSTKAMNPSKY
QTIRKAGKVHYPVAWVNTMVFDYKGHLRIGELVLHSWSSFPDELEEMLNPMGTVQTNPYT
ENATALHIRFQEYSKQPINYPPFDKILEKAAEIARNSDNAAMAGRGGKKFYVVLKDIMER
DPLSQLCENEMDLIWTLRYDCRENFPQSLPKLLLSLKWNKLEDVAQLQALLQIWPKLLPR
EALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERA
LGNRRIGQMLFWHLRSEVHIPAVSVQFGLILEAYCRGSVAHMKVLAKQVEALNKMKTLNS
LIKLNAMKQSKAKGKDAMHTCLKQNAYREALSDLQSPLNPSVILSELHVEKCRYMDSKMK
PLWIVYNNKMFGGDLVGIIFKNGDDLRQDMLTLQILRLMDILWKEAGLDLRILPYGCLAT
GDHSGLIEAVSSSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNLGEDLDRAIEEFTLS
CAGYCVATYVLGIGDRHSDNIMVRKNGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDF
IHVIQQGKTGNTEKFGRFRQYCEEAYLILRKHGNLFITLFALMLTAGLPELTSVKDIQYL
KDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctgccgtgacagacagccttgacatctgggcagtggattcacagattggtgct
gatggctcaatatctgtggacttcctgttgcccactggaatctacatcaacctggacgtc
cctcgagatgccaccatatctcagattaaacagctgttatggaagcaggcacattcctac
cctctctttcatctcctcatggagattgactcttacatgttctcatgtgtgaatcagact
gctgtgcatgaagaattagaggatgaaacacggagactttgtgatgttagaccctttctt
cctgtccttaaactagtgacaaggaactgtgatccaggagaaaagttggattccagaata
ggtgtccttataggcaaaggtctccatgagttcgatgccttacaagatcctgaagtgaat
gacttccgagctaaaatgaggagaatcagtgaagaaaagattcaatctcttgtgggtctc
tcctggatggactggttgaagcacacttacccaccagagcaggagcctgttatcccagag
agcttccaagataaactctacagtgggaaccttgtagtggctgttcattttgacaattgc
caggatgtatttagtttccaggtgtctcctaacatgaatcccatcaagctgaatgaactg
gcaatccgaaaacgtttgactatccatggaaaagaagatgaggaagttgatcctgctgat
tatgtgctgcaagttagtggaagactggaatatgtctttggtgatcacccattaattcag
ttccagtatatccgcaactgtgtgatgagcaggacccttccccagctgacactggtggag
tgctgcaccataaagaagatgtgtgagcaggagatgattgccatagaagctgccataaac
cgaaaatcctccaacctccctcttcctctgccaccaaaaaaaacaagagcaacaactagt
gtgtgggatatttctaacccattcaagattattctattaaagggtaataaactaaacaca
gaagaaaatgccaaagttcatgttagggctggtcttttccatggcacagagctcctttgt
aaaacaattgtaagcacagaaatatctgggagaagtgaccacatttggaatgaagtgctg
gagtttgaaatcaatgtctgtgatctgccaaggatggcaaggctctgctttgctgtttat
gctgtcatggataagatgaaaactaaaaagtctaccaaggcaatgaatccttccaaatac
caaaccattaggaaagcaggaaaagtgcattatcctgtagcctgggtaaataccatggtg
tttgattataaaggacacttgaggattggagaactggtactgcacagctggtcatcattt
cctgacgaacttgaagaaatgttgaatcccatgggaaccgtccagaccaacccttacact
gagaatgcaacagctttgcacattagatttcaggaatattcaaaacagcctattaattac
cctccctttgataagatacttgaaaaggcagctgagattgcaagaaacagtgacaatgct
gcaatggcgggtcgaggtggtaagaagttttatgttgtgctaaaagatataatggaaaga
gatcctttatctcagctttgtgaaaatgaaatggatctcatttggactttgcgatatgac
tgtcgtgaaaatttcccacaatcgttgccaaaactgctgctctctttaaagtggaacaaa
cttgaagacgttgctcagcttcaggccctcctgcagatctggcccaagctgctgcccagg
gaggctttggagctgctggatttcaattatcctgaccagtacgtcagggaatatgcagtg
gggtgtttgaggcagatgagtgatgaagagctctctcagtatcttctccagcttgtgcaa
gtcctgaagtatgagccttttctggattgtgcactctccaggtttctcttggaaagagca
cttggaaacaggagaataggacagatgttgttctggcacctgaggtcggaggttcacatc
cccgccgtgtcggtgcagtttggtttgattctggaggcttattgcagggggagcgtggct
catatgaaggtgctagctaaacaggtggaagccctcaataaaatgaagactttaaatagt
ctaattaagctgaatgccatgaagcaaagcaaagcaaaaggcaaagatgcaatgcatacg
tgtttgaaacaaaatgcttacagagaagcactttctgacctccagtctcctctgaatcct
tctgttatactctcagagctgcatgttgagaagtgtagatacatggattctaaaatgaag
ccgctctggatagtgtacaacaacaaaatgtttggaggagatcttgtagggatcatcttt
aagaatggtgatgatctccggcaggacatgttgacgctccagattctgcgcttgatggac
attctgtggaaagaggctggcctggatctccggatattgccctatggctgtttagcaact
ggagatcactctggcctcattgaggctgtttctagttcagaaaccattgctgacattcag
ttaaacagcagcaacgttgctgcagctgctgccttcaacaaggatgcgctcttgaactgg
ctgaaggaatacaatttaggagaggacttggatcgagccattgaagaatttactctgtcc
tgtgctggctactgtgtagctacgtatgtgctgggaattggtgacagacacagcgacaat
atcatggtcaggaaaaatgggcagctgtttcacatagattttgggcatattcttggaaac
tttaagtccaagtttggaattaaaagggaacgggtacctttcatactcacctatgatttc
attcatgttattcaacaaggaaaaacagggaacactgaaaaatttggccggttccggcag
tactgtgaggaagcctacctgatcctgcgcaagcacggcaacctatttattaccctcttt
gcactgatgctgactgcagggctgccagagctcacctctgtcaaggacatccagtatctc
aaggactcccttgccctagggaagagtgaggaagaagcactaaaacagttcaagcaaaag
tttgatgaagctctgcgggaaagttggactactaaagtgaactggatggctcacactgtc
agaaaagattacaggtcctag

DBGET integrated database retrieval system