KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102106773Help
Entry
102106773         CDS       T02921                                 

Gene name
GYS1
Definition
(RefSeq) glycogen [starch] synthase, muscle
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102106773 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102106773 (GYS1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    102106773 (GYS1)
Enzymes [BR:phi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102106773 (GYS1)
Glycosyltransferases [BR:phi01003]
 Polysaccharide
  Storage polysaccharide
   102106773 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 573 aa AA seqDB search
MPLARSVSVSSLPGLEDWGGPGAPDNVVLFEVAWEVANKGAFWALADRGHDKRDPKVTKG
DPKVTKGDPKVTKGDPKVTKEDPKVTFWGAEGPQILGFQVHFGRWLIEGSPAVVLLDVGA
TAWSLERWKGELWESCAIGVPWYDREANDAVLFGFLVAWFLGEFAAQSEERPFIVGHFHE
WLAGLGLVLSRARRLPVATIFTTHATLLGRYLCAGSVDFYNNLHSFDVDKEAGERQIYHR
YCLERAAAHCAHVLTTVSHVTAAEAEHLLKRKPGVIGDIGGSFRELWGPRVTPGDPLQVN
GSEVTVVAFFIMPARTNNFNVESLKGQAVRKQLCAPPNPKNSRGNLPDMNKMLDREDFTM
MKRAIFATQRQSFPPVCTHNMLDDATDPILTTIRRIGLFNSSNDRVKIIFHPEFLSSTSP
LLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPSA
YGIYIVDRRFRAPEESCAQLTAFLYGFCQQSRRQRIVQRNRTERLSDLLDWKYLGRYYTF
ARRMALAKAFPESFTYEPPEAAAVRGWQEFGGP
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggcccgcagtgtgtccgtgagctccctgccggggctggaggactgggggggt
cccggcgcccccgacaacgtcgtgctcttcgaggtggcctgggaagtggccaacaaaggt
gcattttgggcgctggctgatcgagggcatgacaaaagagaccccaaagtgacaaaaggg
gatcccaaagtgacaaaaggggaccccaaagtgacaaaaggggaccccaaagtgacaaaa
gaggatcccaaagtgacattttggggtgctgagggaccccaaattttggggttccaggtg
cattttgggcgctggctgatcgagggcagcccggccgtggtgctgctggacgtgggggcc
acggcctggagcctggagcgctggaagggcgagctgtgggagagctgcgccatcggcgtg
ccctggtacgaccgcgaggccaacgacgccgtgctcttcggcttcctggtggcctggttc
ctgggagagtttgcggcgcagagcgaggagcggccgttcatcgtgggtcacttccacgag
tggctggcggggctggggctggtgctgagccgcgcccggcgcttgcccgtggccaccatc
ttcaccacgcacgccaccctgctgggccgctacctgtgcgccgggagcgtggacttctac
aacaacctgcacagctttgacgtggacaaggaggcaggtgagcgccagatctaccaccgg
tactgcctggagcgcgcggccgcgcactgcgcccacgtgctgaccaccgtgtcccacgtc
accgccgccgaggccgagcacctgctcaagcgtaaaccaggggtaattggggacattggg
ggcagttttagggagctttggggaccccgtgtgacacctggggaccccctgcaggtgaat
ggcagcgaggtgacagtggtggcatttttcatcatgcccgccaggaccaacaacttcaac
gtggagtcgctcaagggccaggccgtgcgcaaacagctctgcgcgcccccaaatcccaaa
aattccagggggaacctcccggatatgaacaagatgctggacagggaggatttcaccatg
atgaaaagagccatcttcgccacccagcgtcagtcgttccccccggtgtgcacacacaac
atgctggacgacgccaccgaccccatcctgaccacgatccgcaggatcggcctcttcaac
agcagcaacgacagggtcaagatcattttccaccccgagttcctgtcctccaccagcccc
ctcctgcccgtggactacgaggagttcgtccggggttgccacctgggggtcttcccctcc
tactatgagccctgggggtacaccccggccgagtgcacggtgatggggatccccagcgtc
tccaccaacctgtcgggcttcggctgcttcatggaggagcacatcgccgacccctcggcc
tacgggatctacatcgtggaccggcgtttccgcgctccggaggaatcgtgcgcgcagctg
acggcgttcctgtacggattctgccagcagagccggcggcagcgcatcgtgcagcgcaac
cgcaccgagcgcctctccgacctgctcgactggaaatacctgggcaggtattacaccttc
gcccggcgcatggccctggccaaggccttccccgagagcttcacctacgaaccccccgag
gctgcggctgtgaggggctggcaggaatttgggggtccctga

DBGET integrated database retrieval system