KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102106776Help
Entry
102106776         CDS       T02921                                 

Definition
histone acetyltransferase KAT8-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102106776
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 509 aa AA seqDB search
MAASPQGRQAPPPTAASRPFPSPSNRFPPFPSLLATPPQARFPPFFPSPSNPLPPRRGAD
VTSVALQDGGGCGRRARGGPGGSRGPSQSLPVCFQLLPVPPSPSRSVPSPSQSLPVHSQS
VADSAEVIQSRLNEQEAREEFYVHYVGFNRRLDEWVGRERLALSKSLKEAAQKSSEPFLA
ELAEPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGHYEI
DAWYFSPFPEDYGKQPKLWICEFCLKYMKMERSYRIHLGQCQWRQPPGREIYRKGNISVY
EVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYLLTEVDRQGAHIVGYFSKEKESP
DGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVL
LEILRDFRGTLSIKDLSQMTSITQTDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSA
QYKKPPITVDSICLRWAPPKHKQAKVAKK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcccctcagggacgccaggccccgcccccaacagcggcttcccgccctttc
ccgtctcctagcaaccgattcccgccctttcccagtctcctagcaacgcccccccaggcc
cggttcccgccctttttcccgtctcctagcaacccgctcccgcctcgccgcggcgctgac
gtcacttccgtcgcgctgcaagatggcggcggctgcgggcggcgggcccggggaggcccc
ggaggctcccggggtccatcccagtcgctcccagtctgtttccagttgctcccagtccct
cccagtccatcccggtccgttcccagtccctcccagtccctcccagttcactcccagtcc
gttgcagactcggccgaggtgatccagtcccgcctgaacgagcaggaggcgcgggaggag
ttctacgtgcactacgtgggctttaaccggcggctggacgagtgggtgggccgggagcgg
ctggcgctcagtaagagcctcaaggaggccgcccagaagagctcggagccgttcctggcg
gagctggccgagcccgagcggaaaatcacccggaaccagaaacggaaacacgacgagatc
aaccacgtgcagaagacctacgccgagatggacccgaccacggcggcgctggagaaggag
cacgaggccatcaccaaggtgaagtacgtggacaagatccacatcgggcactacgagatc
gacgcctggtacttctcgcccttccccgaggattacgggaaacaaccgaaactgtggatt
tgtgaattctgcctgaaatacatgaaaatggagaggagctacaggatacacctgggtcag
tgccagtggcggcagccgccggggcgggagatttaccgcaaggggaacatctcggtctat
gaggtggacggcaaagatcacaagatctattgccagaacctgtgcctgctggccaagctg
ttcctggaccacaagactctttatttcgacgtggagccgttcgtgttttacctgctcacc
gaggtggatcggcagggagcgcacatcgtggggtacttctccaaggagaaggagtctccg
gacgggaacaacgtggcgtgcatcctcaccctgcccccgtaccagcgccgcggctacggg
aaattcctcatcgccttcagctacgagctgtccaagctggagagcaccgtgggctccccg
gagaagccgctctcggacctgggcaagctcagctaccgcagctactggtcctgggtgctg
ctggagatcctcagggacttccgggggaccctctccatcaaggacctcagccagatgacg
agcatcacgcagaccgacatcatcagcacgctgcagtcgctgaacatggtgaagtactgg
aaggggcagcacgtcatctgcgtcacccccaagctggtggaggagcacctcaagagcgcc
cagtacaagaaaccgcccatcaccgtggattccatctgcctgcgctgggcgcccccgaag
cacaaacaggccaaggtggccaagaagtga

DBGET integrated database retrieval system