KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102106776Help
Entry
102106776         CDS       T02921                                 

Gene name
KAT8
Definition
(RefSeq) lysine acetyltransferase 8
  KO
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102106776 (KAT8)
Chromosome [BR:phi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102106776 (KAT8)
   HAT complexes
    NSL complex
     102106776 (KAT8)
    MSL complex
     102106776 (KAT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 421 aa AA seqDB search
TRSRLAAALTSLPSRCKMAAAAGGGPGEAPEAPGDSAEVIQSRLNEQEAREEFYVHYVGF
NRRLDEWVGRERLALSKSLKEAAQKSSEPFLAELAEPERKITRNQKRKHDEINHVQKTYA
EMDPTTAALEKEHEAITKVKYVDKIHIGHYEIDAWYFSPFPEDYGKQPKLWICEFCLKYM
KMERSYRIHLGQCQWRQPPGREIYRKGNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLY
FDVEPFVFYLLTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSY
ELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQTDII
STLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSICLRWAPPKHKQAKVAK
K
NT seq 1268 nt NT seq  +upstreamnt  +downstreamnt
caacccgctcccgcctcgccgcggcgctgacgtcacttccgtcgcgctgcaagatggcgg
cggctgcgggcggcgggcccggggaggccccggaggctcccggggactcggccgaggtga
tccagtcccgcctgaacgagcaggaggcgcgggaggagttctacgtgcactacgtgggct
ttaaccggcggctggacgagtgggtgggccgggagcggctggcgctcagtaagagcctca
aggaggccgcccagaagagctcggagccgttcctggcggagctggccgagcccgagcgga
aaatcacccggaaccagaaacggaaacacgacgagatcaaccacgtgcagaagacctacg
ccgagatggacccgaccacggcggcgctggagaaggagcacgaggccatcaccaaggtga
agtacgtggacaagatccacatcgggcactacgagatcgacgcctggtacttctcgccct
tccccgaggattacgggaaacaaccgaaactgtggatttgtgaattctgcctgaaataca
tgaaaatggagaggagctacaggatacacctgggtcagtgccagtggcggcagccgccgg
ggcgggagatttaccgcaaggggaacatctcggtctatgaggtggacggcaaagatcaca
agatctattgccagaacctgtgcctgctggccaagctgttcctggaccacaagactcttt
atttcgacgtggagccgttcgtgttttacctgctcaccgaggtggatcggcagggagcgc
acatcgtggggtacttctccaaggagaaggagtctccggacgggaacaacgtggcgtgca
tcctcaccctgcccccgtaccagcgccgcggctacgggaaattcctcatcgccttcagct
acgagctgtccaagctggagagcaccgtgggctccccggagaagccgctctcggacctgg
gcaagctcagctaccgcagctactggtcctgggtgctgctggagatcctcagggacttcc
gggggaccctctccatcaaggacctcagccagatgacgagcatcacgcagaccgacatca
tcagcacgctgcagtcgctgaacatggtgaagtactggaaggggcagcacgtcatctgcg
tcacccccaagctggtggaggagcacctcaagagcgcccagtacaagaaaccgcccatca
ccgtggattccatctgcctgcgctgggcgcccccgaagcacaaacaggccaaggtggcca
agaagtga

DBGET integrated database retrieval system