KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102107125Help
Entry
102107125         CDS       T02921                                 

Gene name
PADI2
Definition
peptidyl arginine deiminase, type II
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     102107125 (PADI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 666 aa AA seqDB search
MPGEPRTLRLQHGNRIEALCVLGSHIRADVFGAAPAGAVAFGVKHTEGVSVDVLFRGRAE
PEAASGAGTRWPLDEGTVLRFSMSRASSEVNDNKVTVSFYAEGGKPINQAGVFLTGVGIS
LDVDADRDGVVEKNSPNKASWAWGPEGHGAILLVSCDKEFPFIPPSDCDSEQVFNREDLL
DLAQMVLRTEGPQRLPRGYEIVLSISVNNADKVGVFHVQNPFFGQRYVQVLGRRKLFHAV
PYPGGAAELHFFVEGLRFPDETFSGLVSIHVSLLEPLAEGIPHSPIFRDTVVFRVAPWIM
TPNTLPPLNLFVCSMKDNYLFTKEIQSLVAKAGCKLKLCFGYINRGDRWMQDEIELGYTH
APHKSFPVVLDSPRERGMEQLPVKELLGPDFGYVHKEPLVEAVASLDSFGNVEVSPPVSV
AGKEYPLGRILIGSSFPASAGRRMTRLVRDFLFAQRVQAPVELYSDWLAVGNVNEFVTFV
PASDKKRFRMLLASPAACYRLFREKQKEGQGEATMFKGYSGTDTKRITINKVLSNDALAQ
QNQYVQRCIDWNRDILKKELGLLEEDIIDLPALFKLDKQGKAVPYFPNTVTMMVLARDLG
IPKPFGPVAGGECCLERRIRALLEPLGLRCRFLEDVASYHGSLGEVRCGTSVQRRPFAFK
WWHFTP
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgccgggggagccccgcacgctgcggctgcagcacgggaaccgcatcgaggccctgtgc
gtgctgggcagccacatccgcgccgacgtcttcggggcggcccccgccggggccgtggcc
tttggcgtgaagcacacggaaggggtcagcgtggacgtgctgttccgtggccgcgccgag
cccgaggctgcgtccggcgcaggaacgcggtggccgctggacgaggggacggtgctgagg
ttcagcatgagccgggccagctccgaggtcaacgacaacaaggtcaccgtcagcttttac
gcagagggagggaagcccatcaaccaagccggggtgttcctcaccggcgtcgggatctcc
ctggacgtggacgcggatcgggatggagtggtggaaaagaacagccccaacaaggccagc
tgggcctggggaccggagggacacggggccatcctgctggtcagctgtgacaaggagttc
cccttcatcccaccctccgactgcgacagcgagcaggtgttcaacagggaagatttgctg
gacttggctcagatggtgctgaggacagaggggccccagcgcctgccccgggggtacgaa
atcgtcctctccatttccgtcaacaacgccgacaaagtcggggtcttccatgtgcagaat
cccttcttcgggcagcgctacgtgcaggtgctgggccgcaggaagctgttccacgccgtg
ccctaccccggcggggccgccgagctccacttcttcgtggaggggctgcgcttccccgac
gagaccttctccgggctggtgtccatccatgtcagcctcctggagccactggccgagggc
atcccccactcgccgatcttcagggacaccgtggtgttccgggtggcgccgtggatcatg
acccccaacacgctgcccccgctgaacctcttcgtctgcagcatgaaggacaactacctg
ttcactaaggagatccagagcctggtggccaaggctggctgcaagctgaagctttgcttc
ggctacatcaaccgcggggaccgctggatgcaggatgagatcgagctcggctacacccac
gctccccacaagagcttcccggtggtgctggactcccctcgggagagagggatggagcag
ctccccgtcaaggagctgctgggccccgatttcggctacgtgcacaaggaacccctggtt
gaggccgtggccagcctggactccttcgggaacgtggaggtcagcccgcctgtgtccgtg
gctggcaaggagtatcccttgggaaggatcctcatcggcagcagcttccctgcatccgcg
ggccgcaggatgaccaggctggtgcgggatttcctcttcgcccagcgcgtccaggccccc
gtggagctctactccgactggctggccgtgggcaacgtcaacgagttcgtcaccttcgtg
cccgcctctgacaaaaagcgattccggatgctgctggccagtccggccgcctgctaccgg
ctcttccgcgagaagcagaaggagggacagggagaagccaccatgttcaaagggtactcg
gggacagacaccaagcgcatcaccatcaacaaggtcctttccaacgacgccctggcgcag
cagaaccagtacgtccagcgctgcatcgactggaacagggatatcctcaagaaggagctg
gggctgctggaggaggacatcatcgacctgccggccctcttcaagctggacaagcaggga
aaagccgttccctacttccccaacacggtcaccatgatggtgctggccagggacctgggc
atccccaagccgtttgggccggtggcgggcggcgagtgctgcctggagcggcggatccgg
gcgctgctggagccgctggggctgcgctgccgtttcctggaggacgtggcctcgtaccac
ggcagcctgggcgaggtgcgctgcggcaccagcgtccagcgccggcctttcgccttcaag
tggtggcacttcacgccgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system