KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102107144Help
Entry
102107144         CDS       T02921                                 

Definition
(RefSeq) GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1-like
  KO
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102107144
Cellular antigens [BR:phi04090]
 Proteins
  102107144
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:phi00537]
 Enzymes
  102107144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 310 aa AA seqDB search
MTWMTTMTVMTTMTVMTTTTAVTAATTVPATVPTPLLVPLDMAPDSFDDRYRGCGRAMTA
ALPALNRSELLRGGHLAEAWALAEAERRVRPSPASPASPLSPAQLTALLAYTAPVPLHRT
FNAAVRASGRSGREYRHNFHFKALHFLLSSALSALRDARGPRCHRVFRGVRGVRFEARPG
RTVRFGHFASASLRNESSWSFGMDTAFQVSTCQGVDIHEFSFFPHEEEVLIPPFETFQVT
EVTRVTAGGDTGGDTGDTGGVTVRIGLRSTGVFSKYNCEWLRGGSVPRPLPHLGWLLLAT
TALAVATGTF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacctggatgaccacgatgaccgtgatgaccacgatgacagtgatgaccaccacgacc
gcagtgaccgcggccaccaccgtcccggccaccgtccccacgcctctgctggttcctctg
gacatggccccggactccttcgatgaccggtaccggggctgcggccgcgccatgaccgcg
gccctgccggccctcaaccgctccgagctgctccggggcggtcacttggccgaggcctgg
gccctggccgaggccgaacggcgcgtccggccgtccccggcgtcacccgcgtcccctctg
tccccggcccagctcacggccctgctggcctacacggcgccggttccgctgcaccggacc
ttcaacgccgccgtccgcgcgtccggccgctccggccgcgagtaccgccacaatttccac
ttcaaggcgctgcatttcctgctgagcagcgccctgagcgcgctgcgcgacgcgcgggga
ccgcggtgccaccgcgtgttccgcggggtgcgcggggtgcgcttcgaggcgcggccgggc
cggacggttcggttcggtcacttcgcttcggcctcgctgcggaacgagagctcctggagc
ttcgggatggacacggcgttccaggtgagcacctgccaaggtgtggacatccacgagttc
tccttcttcccgcacgaggaggaggtgctgatcccgcccttcgagaccttccaggtgacg
gaggtgacgcgcgtcaccgccggaggggacaccggaggggacaccggggacaccggaggg
gtcacggtgaggatcgggctgcgctccaccggtgtcttcagcaaatacaactgcgagtgg
ctgagaggtgggagtgtccccaggcccctcccccacctcgggtggctcctcctggccacc
acagccctggcagtggccaccgggaccttctga

DBGET integrated database retrieval system