KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102107385Help
Entry
102107385         CDS       T02921                                 

Definition
NADH-cytochrome b5 reductase 2-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    102107385
Enzymes [BR:phi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     102107385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 304 aa AA seqDB search
MEALAGAPVAVAVAVVAASALLLLLLRGTARRPSGPVTLQDPLAKYPLRLLDKEEISHDT
KKFRFGLPSTNHILGLPVGQHVYLSAKIDGNLVIRAYTPVSTDKTKGYVDLIIKVYHKNV
NPKFPEGGKMSQYLDNMKIGDTIDFRGPNGLLVYKGTGTFLIKPNKKSEAEKKFAKHLGM
IAGGTGITPMLQLIRQITSDPKDSTKCYLLFANQTENDILLRAELEDIAKRHPEQFVLWY
TLDRPPKDWKYSSGFVTAEMLEAHLPPPGSETLILMCGPPPMIQFACQPNLDKLGYPKSS
TFAY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgcttgcgggagcgcctgtggccgtggccgtggccgtggtggccgcgtccgcc
ctgctgctgctgctgctccgcgggacggcgcggaggccgagcggccccgtcacgctgcag
gacccgctcgccaagtacccgctgcggctgctggacaaggaggaaatcagtcacgatact
aagaaattcagatttgggctaccctcaacaaatcatatattaggattacctgtaggccaa
catgtttacctttctgcaaaaattgatgggaatctggtgatccgagcctataccccagtt
tccactgacaagacaaaaggttatgttgatttaattataaaggtctaccacaaaaatgtg
aaccccaagtttccagaaggtgggaagatgtcccagtatctggataacatgaagattgga
gataccattgatttcagagggccaaatggactcctggtctataaggggacaggtaccttt
ctgatcaagcctaataagaagtctgaggcagagaaaaagtttgcaaagcaccttgggatg
atagctggaggaacaggaataactcctatgttgcagctgatccgtcagatcacaagcgac
cccaaggactccacaaaatgttacctcctttttgctaatcagacagaaaatgatatattg
ctgagagctgagctagaagacattgccaagaggcaccctgagcagtttgtgctgtggtac
acactggacagacctccaaaagactggaagtacagctctggctttgtcactgcagagatg
ctggaagcccacctgcctccccctggcagcgagaccctcattctcatgtgtgggccacca
ccaatgattcagtttgcctgtcagcccaacctggacaagcttggctatcccaagagcagt
acatttgcttattaa

DBGET integrated database retrieval system