KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102107408Help
Entry
102107408         CDS       T02921                                 

Gene name
ART4
Definition
ADP-ribosyltransferase 4 (Dombrock blood group)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102107408 (ART4)
Cellular antigens [BR:phi04090]
 Proteins
  102107408 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 301 aa AA seqDB search
MFYSVSWVDSGKLVTLGSLLLLIFSQILVKEAMSPTLMDMALHSFDDQYLGCREEMMEEL
EQGDYFQKEIADNKDYFRLWKKAQEALLKSPVGLLREMRASHAIVLMAYTMNSSLHSQLN
RATSTAGISPEHYRHKFSFKYFHFYLTTAIQILKEWQSSRGEHKCYQVHRGVKDLHIEAK
VGSRVRFGHFTSTSRLRSEAQKFGNETLFTVTTCLGAAVQGFSYHISEKEVLIPPYEIFL
VKSFFQTQQGNQLHLHSVGNSSKYQCQLVEASRSENSGYTALISAILPGVLGVSLCLAHS
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgttctattcagtctcttgggtggactctgggaagctggtgacactgggtagcctcttg
ttgctgatcttctcacaaatactggtaaaagaggctatgtctcccaccctgatggatatg
gctctgcattcctttgatgaccagtacctggggtgcagagaggagatgatggaagaactg
gagcaaggagactattttcaaaaggaaatagctgataacaaggactactttcgtctctgg
aagaaggctcaggaggctttgctaaagagccctgtaggtctcttaagggaaatgcgtgcc
agccatgccatagtcctcatggcttacaccatgaactcctccctgcactcgcagctgaac
cgggctacatctacagcaggaatctctccagagcactacagacacaagttcagttttaaa
tattttcacttctacctaacaactgctatccagatattgaaggaatggcagagcagcagg
ggggaacataagtgctaccaggtgcacaggggtgtaaaggacttacatatcgaggccaag
gtaggcagcagggtgcgatttggccatttcacttctacctctcgcctcaggagtgaagcc
cagaagtttgggaatgaaactttgttcactgtgaccacttgcctgggagcagctgtgcaa
ggcttttcttatcatatatctgagaaggaagtcctcattcccccttatgagatatttctt
gtcaaaagcttctttcagacccagcagggcaaccagctgcatctgcattctgtggggaac
tccagcaagtaccagtgccagctggtggaagcttcaagaagcgagaacagtggttatact
gcactcatctctgccattctccctggtgtgcttggagtttccttgtgcttggcccacagt
ctctga

DBGET integrated database retrieval system