KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102107539Help
Entry
102107539         CDS       T02921                                 

Gene name
BAP1
Definition
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102107539 (BAP1)
Peptidases [BR:phi01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102107539 (BAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 717 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRR
KVSTLVDETSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCNNVDLGPTLSRMKDFTK
GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKGRL
FELDGLKVYPIDHGPWADDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRMK
YESKLHILKMNRQTVLEALQQLIRVTQPELIQTQKSQESQPAEEAKPASSKTVTPESTHP
DGTDEPTSQGHPTATQSPPSKSKPVPKTTASGINGAPPANPNPIVQRLPAFLDNHNYAKS
PMQEEEDLAAGVGRNRVPVRQHQQYSDDEDDYDDDDEEEVRNTNSAIRYKRKGQVKQEHV
AGAADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGGAAVAVVTHSQPSPTPSNE
STDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEEDGLLRVDCMRYNRAVR
DLGPIVSSGLLHLTEDGVFCPLAAADGKNSPSSIKPGEEAPVAIKLEEKEGSEASDSKEK
VGLGRTSDHPGGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYD
EFICTFISMLAQEGMLASLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgaataagggctggctggagctggagagcgatcccggtcttttcacactcctggttgaa
gattttggggtcaagggagtgcaggttgaggagatttatgatctgcagagcaaatgccaa
ggccccgtgtatgggttcatcttcctgttcaagtggattgaggagcgccggtcccgccgg
aaggtctccacgctggtggatgagacgtcagtgatcgatgatgacatcgtcaataacatg
ttctttgctcaccagctgatccccaattcctgtgccacccatgccctgctgagcgtcctc
ctgaactgcaacaatgttgacctggggcccacgctgagccgcatgaaggatttcaccaaa
ggcttcagccctgagagcaaaggctatgccattggcaacgccccggagctggccaaggcc
cacaacagccatgccaggccagagccgcggcacttgccggagaagcagaacgggatcagc
gcagtgcggaccatggaggcttttcattttgtcagctatgtccccatcaagggacggctc
tttgagctggatgggctgaaggtctatcccattgaccacgggccatgggcagatgatgag
gaatggacggacaaagccaggagagtgatcatggagcgcattggcctggccactgcaggg
gagccgtaccacgatatccgcttcaacctgatggccgtggtgcctgaccggaggatgaag
tacgagtccaaactgcacatcctgaagatgaaccgccagactgtgctggaggccttgcag
cagcttatccgagtaactcagcctgagctgatccagacccagaagtctcaggagtctcag
cctgctgaagaggcaaagccagccagcagcaagaccgtgactccagagagcactcatcca
gatggcactgatgaacccaccagccagggccaccccacggccacacagagcccacccagc
aaatccaaaccggtgccaaagacaacagcgagcggcatcaatggggcccctccagcaaac
cccaaccccattgtgcagagactgccagccttcctggataatcacaactatgccaagtcc
cccatgcaggaggaggaagaccttgcggcaggagtaggtcgcaaccgagtcccagtccga
caacaccagcagtactcggatgatgaggatgactatgatgatgatgatgaggaggaagtt
cgtaataccaactcagccatcaggtacaagaggaaagggcaagtgaagcaagagcacgtg
gcaggggccgcagatggccagctctccgtcctgcagcccaataccatcaacgtcctggct
gagaagctgaaggaatctcaaaaggatctttccattcccctgtccatcaagacgagcagc
gggggtgccgccgtggcagtggtcacccactcccagccctcccccacccccagcaacgag
agcacagacactgcctccgagatcggcagcgccttcaactccccgctgcgctccccaatc
cgctcggccaaccccacgcgcccctccagccccgtcacctcccacatctccaaggtgctg
tttggcgaggaggacgggctgctgcgcgtcgactgcatgcgctacaaccgggccgtcagg
gacctggggcccattgtcagctccgggctgctgcacctcaccgaggatggcgtgttctgc
ccgctggctgctgcagatgggaaaaactccccctcttccatcaaacccggtgaagaggcc
ccggttgcgatcaaactggaggagaaggagggcagtgaggccagtgacagcaaagagaag
gtgggacttggcaggaccagtgatcaccctgggggggaaaagtattctcccaaggagctg
ctggcgctgctcaagtgtgtggaagcagagattgcaaactatgaagcctgcctgaaggag
gaagtagagaagaggaagaaattcaagattgatgaccagaggagaacccacaactatgat
gagttcatctgtaccttcatatccatgctggcccaggaaggcatgctggccagcctcgtg
gagcagaacatctctgtgcgcaggcggcagggagtcagcatcggccgcctgcacaagcag
aggaagccggaccgccggaaacgctcccgcccctacaaagccaagcgccagtag

DBGET integrated database retrieval system