KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102107561Help
Entry
102107561         CDS       T02921                                 

Definition
beta-galactoside alpha-2,6-sialyltransferase 1-like
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:phi00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:phi00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 413 aa AA seqDB search
MVHINVLKKFMCVLVVILIALTVCLWRETRRSYYDPLKTSSDDFQGHRSLEKWNLVKSQG
LFHEAAGELGQVSKMWLGTQNKVKGSTSEAAEKSKKAAFGKVWDKDSSSRNLIPRLQKVR
KNYLAMNKYNVSYNGKRNAKLSPEKLLCQLRDRVNVTMIQKSDGPFGTSEWQQYLPGKSL
SETVGHLGRCAVVSSAGSLKSSRLGQEIDSHDAVLRFNGAPVRGFQDDVGQKTTIRLVNS
QLVTVEEQQFLREPLYNTGILIVWDPAPYHAEIHEWYRKPDYNFFESYKAYRRVHPEQPF
YILNPKMQWQLWDILQENSLEHIQPNPPSSGMLGIVLMMTLCDQVDVYEFLPSKRQTDIC
HYYQKFHDHACTMGAYHPLLFEKNLVKHMNQGTDEDIYTHGKVTLPGFQKVHC
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggttcacatcaatgtgttgaaaaagttcatgtgtgttcttgtggtgatactgatagca
ctgacagtttgcctctggagagaaacaagaagaagctactatgatcctttgaagaccagc
agtgatgattttcaggggcacaggagtttggagaaatggaacctggttaaatcacaaggc
cttttccatgaagcagctggtgaactggggcaggtatccaaaatgtggcttggtacccaa
aacaaagtgaaaggcagcacctctgaagcagctgaaaagtccaagaaagcagcctttggg
aaggtatgggataaggacagctcatccagaaatctcatacccaggctgcagaaggtcagg
aaaaactacctggccatgaacaagtacaacgtgagctacaatggaaagaggaacgctaag
ctcagcccagagaagctgctctgccagctgcgggacagggtcaatgtgaccatgatacag
aagtcagatggtccttttggtacctctgaatggcagcaatacctgccagggaaaagcctc
agtgaaacagtgggacacttgggtcgctgtgctgtcgtgtcctcagcagggtctctgaaa
tcatctcgcttgggacaagagatagacagccacgacgccgtcttgcggttcaatggggct
cctgtcaggggcttccaagatgatgtggggcaaaagacaacaattcgtcttgtgaattcc
cagcttgtaactgttgaagagcagcagttcctgagggaaccactatataacactggaatc
ttaattgtctgggatccagcaccatatcatgcagaaattcatgagtggtacagaaaacca
gattacaacttttttgaaagctataaggcatatcgtagagtgcatccagagcagcccttc
tatatcctgaatcccaaaatgcagtggcagctctgggatattctgcaggagaattccctg
gagcatattcagcctaatccaccatcatcaggaatgcttggcatcgtgctcatgatgacg
ctgtgtgaccaagtggacgtgtacgaatttctcccttccaagcggcagacggacatttgc
cactattaccagaagttccacgaccatgcctgcaccatgggagcttaccaccccctcctg
tttgagaagaacttggtgaagcacatgaaccagggcacagatgaggacatctacactcac
ggcaaagtcaccctgcctggcttccaaaaagtgcattgctag

DBGET integrated database retrieval system