KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102107845Help
Entry
102107845         CDS       T02921                                 

Gene name
POR
Definition
P450 (cytochrome) oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 677 aa AA seqDB search
MGEPSMDPTISAADSPAQQDSLFSMMDVFLISLITGLFTYWFFFRKKKEEVPDLPKMQSV
AAPVRDSSFIEKMKKTGRNIVVFYGSQTGTAEEFANRLSKDAHRYGLRGMAADPEEYDLS
DLSRLSEIDKSLAVFCMATYGEGDPTDNAQDFYDWLQEADADLSGLRFAVFGLGNKTYEH
FNAMGKYVDKRLEELGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEES
SIRQYELVVHTDVNMNKVYTGEMGRLKSYENQKPPFDAKNPFLAQVTENRKLNEGGERHL
MHLELDISNSKIRYESGDHVAVYPANDSSLVNQIGEILGTDLDTIMSLNNLDEESNKKHP
FPCPTSYRTALTYYLDITNPPRTNVLYELAQYATDAGEQERLRKMASSAAEGKALYLSWV
VEARRNILAILQDMSSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSIHICAVTVEYKT
KTGRLNKGVATNWLKSKVPDQNGSSSLVPMYVRKSQFRLPFKPSTPVIMIGPGTGIAPFI
GFIQERAWLKQQGKEVGETVLYYGCRRQHEDYLYREELAHFQKEGVLTQLNVAFSRDQAE
KVYVQHLLKKNKENVWKLVNEGMAHIYVCGDARNMARDVQNTFYEIVSEFGNMSQPQAVD
YVKKLMTKGRYSLDVWS
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgggggaacccagcatggacccaaccatctctgctgccgacagccctgcacagcaggac
tctctcttcagcatgatggacgtgttcctcatctccctcatcactggactttttacctac
tggttcttcttccgcaagaaaaaggaggaagtgcctgacctccccaaaatgcagtcagta
gcagctccagtgagggacagcagcttcattgagaagatgaagaagacgggccgaaatata
gtggttttctatggttcccagacgggcacagcagaggagtttgccaatcgcctctccaaa
gatgcccatcgctatggcctccggggcatggcagcagatccagaggagtatgacctgtca
gacctgagtcgcctctctgagattgacaagtccttggctgtgttctgcatggccacctat
ggagagggggatcccacggataatgcccaggatttctacgactggctgcaggaggctgat
gccgacctgtcgggtctccgctttgcagtctttgggctggggaacaagacttacgagcac
ttcaacgccatgggaaagtacgtggataagagactggaggaacttggagcccagcgcatc
tttgagctggggctgggagatgacgatggcaacctggaagaagacttcatcacctggaga
gagcagttctggccagcagtgtgtgagcacttcggggtggaggctacaggagaagagtcc
agcatccggcagtacgagctggtggtgcacacagatgtcaacatgaacaaagtctacacg
ggggagatgggccggctcaagagctacgagaaccagaagcccccatttgatgccaagaac
cctttcctggctcaggttacagagaaccgcaagctgaacgagggtggagagcggcacttg
atgcacctggagctggatatctccaattccaaaatcaggtacgagtccggcgaccacgtg
gccgtgtacccagccaacgactcctccctggtgaaccagattggtgagatcctgggcacg
gacctggacactatcatgtccctaaacaacttggatgaggaatccaacaagaagcatccc
ttcccctgccccacgtcgtaccggacagccctgacctactacctggacatcaccaaccct
ccccgcaccaacgtcctgtacgagctggcccagtacgccacggacgccggcgagcaggag
cgcctccgtaaaatggcctcgtctgctgctgagggcaaggcgctgtacctcagctgggtg
gtggaggcccgcaggaacatcctggccatcctgcaggacatgtcctccctgcgccccccc
atcgaccacctgtgcgagctcctgccccgcctgcaggcccgctactactccatcgcctcc
tcctccaaggttcatcccaactccatccacatctgtgctgtgaccgtggagtacaagacc
aagactggccgcctgaacaaaggggtggccaccaactggctcaagagcaaggtgcctgac
cagaacgggagcagctccctggtgcccatgtacgtccggaagtcgcaattccggctgccc
ttcaagcccagcacgcccgtgatcatgatcgggcctggcaccggcatcgcccccttcatc
ggcttcatccaggagcgggcttggctgaagcagcagggcaaagaggtgggcgagacggtg
ctttactacggctgccgccgccagcacgaggactacctgtaccgggaggagctggcccac
ttccagaaggagggagtcctcacccagctcaacgtggccttctccagggaccaggctgag
aaggtttatgtccagcacttgctgaagaagaacaaggagaatgtctggaagctggttaac
gaagggatggctcacatctatgtgtgcggcgacgcgcggaacatggcccgggacgtgcag
aacaccttctacgagatcgtgtccgagtttgggaacatgagccagccccaggccgtggac
tatgtaaagaaactgatgacaaagggccgctactccctggatgtgtggagctaa

DBGET integrated database retrieval system