KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102108381Help
Entry
102108381         CDS       T02921                                 

Gene name
CKB
Definition
creatine kinase, brain
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    102108381 (CKB)
Enzymes [BR:phi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     102108381 (CKB)
Exosome [BR:phi04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   102108381 (CKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 381 aa AA seqDB search
MPFSNSHNLLKMKYKPEEEYPDLKAHNNHMAKVLTPDLYKKLRDKQTPSGFTLDDCIQTG
VDNPGHPFIMTVGCVAGDEESYEVFKELFDPVIEDRHGGYKPSDQHKTDLNADNLQGGDD
LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLSVEALGSLEGDLKGKYYALRNMT
DAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISM
QKGGNMKEVFNRFCNGLTKIESLFKAKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKIP
HLGKHEKFGEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
IEMEKRLEKGQSIDDLMPAQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcccttctcaaacagccacaacctcctgaagatgaaatacaagcctgaggaggagtac
cctgacctgaaagctcacaacaatcacatggctaaggtgctgaccccggacctgtacaag
aaattgagagataaacagactcccagtggatttaccctggatgattgcatccagactggg
gttgacaacccaggccatcccttcataatgacagtaggctgcgtggctggtgatgaagaa
tcctatgaagtgttcaaggagctctttgatccagttattgaagacaggcatggtggctac
aaaccaagtgatcagcacaagactgacctgaatgctgataacctgcagggaggtgatgac
ctggatcccaattacgtgctaagctcccgtgtcagaactggcagaagcatccgtggattc
tgtcttcccccgcactgcagtcgaggggagaggcgggctatcgagaagctctctgttgaa
gctctgggtagtctggaaggtgatctcaaggggaagtactatgctctgaggaacatgact
gatgcagagcaacagcagctgattgatgaccacttcttgtttgacaagccagtttctcct
cttctgttggcatctgggatggcacgagactggcctgatgccaggggtatctggcacaac
gataacaagactttccttgtttggatcaatgaggaggatcaccttagagttatttccatg
cagaaaggtggcaacatgaaggaagtatttaaccgcttctgtaatggactaacaaagata
gaaagtctcttcaaggccaaaaactatgagttcatgtggaatccacacttgggctacatc
ctgacgtgcccatccaaccttggaacagggctccgtgctggtgtgcacatcaagatccca
caccttgggaaacatgagaaatttggagaagtcctcaagagacttcggctgcagaaacga
ggcacaggtggtgtggacacagctgctgttggaggagtgtttgatgtctccaatgctgat
cgtcttggcttctctgaggtggagctggtgcagatggtggtggatggagtgaagcttctc
attgaaatggagaaacgccttgaaaaaggccagtccattgatgacctcatgccagctcag
aaataa

DBGET integrated database retrieval system