KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102108425Help
Entry
102108425         CDS       T02921                                 

Definition
(RefSeq) alanine aminotransferase 2-like
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
phi00220  Arginine biosynthesis
phi00250  Alanine, aspartate and glutamate metabolism
phi01100  Metabolic pathways
phi01200  Carbon metabolism
phi01210  2-Oxocarboxylic acid metabolism
phi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102108425
   00220 Arginine biosynthesis
    102108425
Enzymes [BR:phi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     102108425
Amino acid related enzymes [BR:phi01007]
 Aminotransferase (transaminase)
  Class I
   102108425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 102108425
NCBI-ProteinID: XP_005534388
Position
Un
AA seq 502 aa AA seqDB search
MRALRALRPRRLLAMAAAPGGSRRGPVLTPESMNPAIRRVEYAVRGPIVVRALELEQELR
KGVSKPFTEVIKANIGDAHAMGQQPITFLRQVAALCLCPELMKDSSLPSDAKERARRLLS
ACGGQSVGSYSASPGVQMVRENVARYIERRDGVPASPDDIFLSTGASDAIVNILKLLVCG
SGSSRTGVLIPIPQYPLYSAALAELDAAQVRYYLAEERCWALDVAELRRALDEGRRRCSP
RVLCIINPGNPTGQVQSRECIEDVIKFAYEEKLFLMADEVYQDNVYAKGSAFYSFKKVLK
EMGPPYSDSVELASFHSISKGYMGECGLRSGYVEVVNLHPEVKAELSKLVSVRLCPPVLG
QMVLDTIMDPPKPGDPSYERFQAEKEAVLSALAEKARLTQEIFNRTPGIHCNPVQGAMYS
FPRIDLPDGALAAAKEKQQAPDMFFCMRLLEETGICVVPGSGFGQKEGTFHFRMTILPPT
DKLKILLEKLSAFYTKFVKEFS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcgggctctgagggcgctgcggccccgcaggctcctggcgatggcggcggctcccggg
gggtcccggcggggcccggtgctgacccccgagtcgatgaaccccgcgattcgccgcgtg
gagtacgcggtgcgcggccccatcgtggtgcgagcgctggagctggagcaggagctgcgc
aagggtgtctccaagcccttcaccgaagtcatcaaggccaacatcggtgacgcgcacgcc
atgggccagcagcccatcaccttcctccgccaggtggccgcgctctgcctgtgcccggag
ctcatgaaggactcgtccctccccagcgacgccaaggagcgagcgcggcgacttctatcg
gcctgcggtggccagagcgtgggttcctacagcgccagccccggcgtgcagatggtgcgg
gagaacgtggcgcgctacatcgagcggcgcgatggtgtccccgccagccccgacgacatc
ttcctgtccacgggcgccagcgacgccatcgtgaacatcctgaagctgttggtgtgcggt
tcgggctcgtctcgcacgggtgttctgatcccgatcccgcagtacccgctctactcggcg
gcgctggcggagctggacgcggcgcaggtccgttactacctggccgaggagcgctgctgg
gcgctggacgtggccgagctgcgccgggcgctggacgaggggcgccgccgctgctcgccg
cgggtgctctgcatcatcaaccccggcaaccccaccggccaggtgcagagccgggaatgc
atcgaggacgtcatcaagttcgcctacgaggagaagcttttcctcatggccgacgaggtg
taccaggacaacgtctacgccaagggctcggccttctactcgttcaagaaggtcctgaag
gagatggggccgccctactcggattcggtggagttggcctccttccactccatctccaag
ggatacatgggagagtgtgggctgcggagcggttacgtggaggtggtgaacctgcacccc
gaggtgaaggccgagctctccaagctcgtgtcggtccggctgtgcccgcccgtgctggga
cagatggtcctggacaccatcatggatccgccaaagcccggagatccgtcctacgagcgc
ttccaggctgagaaggaggccgtgctcagcgccctggcggaaaaggcgcggctgacgcag
gagatcttcaaccggaccccggggatccactgcaaccccgtgcagggagccatgtactcc
ttcccccggatcgacctcccggatggagcgctggctgccgccaaggagaagcagcaggcc
ccggacatgttcttctgcatgaggctcctggaggaaaccgggatctgcgtcgtcccggga
agcggcttcggacagaaggaaggcaccttccacttccggatgacgatcctgcctcccacg
gacaaactgaaaatcctcctggaaaaactcagcgccttctacaccaaatttgtcaaggaa
ttctcttaa

DBGET integrated database retrieval system