KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102108425Help
Entry
102108425         CDS       T02921                                 

Definition
alanine aminotransferase 2-like
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    102108425
   01210 2-Oxocarboxylic acid metabolism
    102108425
   01230 Biosynthesis of amino acids
    102108425
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102108425
Enzymes [BR:phi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     102108425
Amino acid related enzymes [BR:phi01007]
 Aminotransferase (transaminase)
  Class I
   102108425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 470 aa AA seqDB search
MNPAIRRVEYAVRGPIVVRALELEQELRKGVSKPFTEVIKANIGDAHAMGQQPITFLRQV
AALCLCPELMKDSSLPSDAKERARRLLSACGGQSVGSYSASPGVQMVRENVARYIERRDG
VPASPDDIFLSTGASDAIVNILKLLVCGSGSSRTGVLIPIPQYPLYSAALAELDAAQVRY
YLAEERCWALDVAELRRALDEGRRRCSPRVLCIINPGNPTGQVQSRECIEDVIKFAYEEK
LFLMADEVYQDNVYAKGSAFYSFKKVLKEMGPPYSDSVELASFHSISKGYMGECGLRSGY
VEVVNLHPEVKAELSKLVSVRLCPPVLGQMVLDTIMDPPKPGDPSYERFQAEKEAVLSAL
AEKARLTQEIFNRTPGIHCNPVQGAMYSFPRIDLPDGALAAAKEKQQAPDMFFCMRLLEE
TGICVVPGSGFGQKEGTFHFRMTILPPTDKLKILLEKLSAFYTKFVKEFS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgcgattcgccgcgtggagtacgcggtgcgcggccccatcgtggtgcgagcg
ctggagctggagcaggagctgcgcaagggtgtctccaagcccttcaccgaagtcatcaag
gccaacatcggtgacgcgcacgccatgggccagcagcccatcaccttcctccgccaggtg
gccgcgctctgcctgtgcccggagctcatgaaggactcgtccctccccagcgacgccaag
gagcgagcgcggcgacttctatcggcctgcggtggccagagcgtgggttcctacagcgcc
agccccggcgtgcagatggtgcgggagaacgtggcgcgctacatcgagcggcgcgatggt
gtccccgccagccccgacgacatcttcctgtccacgggcgccagcgacgccatcgtgaac
atcctgaagctgttggtgtgcggttcgggctcgtctcgcacgggtgttctgatcccgatc
ccgcagtacccgctctactcggcggcgctggcggagctggacgcggcgcaggtccgttac
tacctggccgaggagcgctgctgggcgctggacgtggccgagctgcgccgggcgctggac
gaggggcgccgccgctgctcgccgcgggtgctctgcatcatcaaccccggcaaccccacc
ggccaggtgcagagccgggaatgcatcgaggacgtcatcaagttcgcctacgaggagaag
cttttcctcatggccgacgaggtgtaccaggacaacgtctacgccaagggctcggccttc
tactcgttcaagaaggtcctgaaggagatggggccgccctactcggattcggtggagttg
gcctccttccactccatctccaagggatacatgggagagtgtgggctgcggagcggttac
gtggaggtggtgaacctgcaccccgaggtgaaggccgagctctccaagctcgtgtcggtc
cggctgtgcccgcccgtgctgggacagatggtcctggacaccatcatggatccgccaaag
cccggagatccgtcctacgagcgcttccaggctgagaaggaggccgtgctcagcgccctg
gcggaaaaggcgcggctgacgcaggagatcttcaaccggaccccggggatccactgcaac
cccgtgcagggagccatgtactccttcccccggatcgacctcccggatggagcgctggct
gccgccaaggagaagcagcaggccccggacatgttcttctgcatgaggctcctggaggaa
accgggatctgcgtcgtcccgggaagcggcttcggacagaaggaaggcaccttccacttc
cggatgacgatcctgcctcccacggacaaactgaaaatcctcctggaaaaactcagcgcc
ttctacaccaaatttgtcaaggaattctcttaa

DBGET integrated database retrieval system