KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102108729Help
Entry
102108729         CDS       T02921                                 

Gene name
ACHE
Definition
(RefSeq) acetylcholinesterase (Yt blood group)
  KO
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    102108729 (ACHE)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     102108729 (ACHE)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:phi00537]
 Enzymes
  102108729 (ACHE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 589 aa AA seqDB search
LAPSPVATEDLLVATSAGAVRGFHVPAGPSSRVAAFLGIPYAEPPLGPLRFAPPRPARPW
GGVLEAVAHPHACFQPVDTMFPGFGGSEMWNPNREMSEDCLYLNIWVPAPRPKAPAPVLV
WIYGGGFYSGAASLDVYDGRFLAAAEEVLVVSMNYRVGALGFLALPGHPEAPGNVGLLDQ
RLALRWVQANIAAFGGDPGAVTLFGESAGAASVGLHLLSGGSRALFRRAVLQSGSPNGPW
ATVGAAEGRRRAARLGRLVGCGGVGAGGAVTNETELLGCLRAAAPPQLVEHEAAVLPQQG
VFRFAFVPVVDGEFLADTPEALLGGPGRAEAEVLLGAVQDEGTYFLVYGVPGFGKDNESL
ISREEFLGGVRLGVPQANELAAEAVVLQYTDWLDQDNPVKNREALDDIVGDHNVVCPLMH
FAQRWAERGGTVFAYLFDHRASNLLWPPWMGVPHGYEIEFVFGQPLNPGLNYTAEEEALS
RRIMRYWGNFARTGDPNEPSERERRWPSYTAEGQSYARLNARPLAVAQGLRAQACAFWTR
FLPKLLNVTGPMEEAERQWRLEFHRWSSYMMRWKSQFELYSRQERCQPL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
ctcgccccctcccccgtggccaccgaggacctgctggtggccacctcggccggcgccgtc
cgcggcttccacgtgcccgccggcccctcctcgcgcgtggccgcgtttttggggatcccc
tacgccgagccccccctgggacccctgcgcttcgcccccccccgccccgcccggccctgg
ggaggggtcctggaggccgtagcccacccccacgcctgcttccagccggtcgacaccatg
ttcccgggcttcggcggctccgagatgtggaaccccaaccgggagatgagcgaggattgt
ttgtacctcaacatttgggtgccggccccgcgccccaaggcgccggcgccggtgctggtg
tggatttacggggggggcttctacagcggcgccgcctcgctggacgtctacgacgggcgg
ttcctggcggccgccgaggaggtcttggtggtctccatgaactacagggtgggcgccttg
ggcttcctggccttgccgggtcaccccgaagcccccggcaacgtggggctgctggaccag
cggctggcgctgcgctgggtccaggccaacatcgcggccttcggcggcgaccccggcgcg
gtgacgctctttggggagagcgcgggcgcggcctcggtggggctgcacctgctgtcgggg
ggcagccgcgccctgttccgccgcgccgtgctgcagagcggctcgcccaacgggccctgg
gccaccgtgggggcggccgagggccggcggcgagcggcgcggctgggccgcttggtgggc
tgcggcggcgtgggcgccggcggcgccgtgaccaacgagacggagctgttgggctgcctg
cgcgccgcggcgccgccgcagctggtggagcacgaggcggccgtgctgccccagcaaggc
gtgttccgcttcgccttcgtgcccgtggtggacggggagttcctggccgacacccccgag
gcgctgctgggcggccccggccgcgccgaggccgaggtgctgctgggcgccgtgcaggac
gagggcacctatttcttggtgtacggcgtgccgggattcggcaaggacaacgagagcctg
atcagccgcgaggagttcctgggcggggtgaggctgggggtgccgcaggccaacgagctg
gcggccgaggccgtggtgctgcagtacacggattggctggaccaggacaacccggtgaag
aaccgcgaggcgctggacgacatcgtgggcgaccacaacgtggtgtgcccgctgatgcac
ttcgcccagcgctgggccgagcgcggcggcaccgtcttcgcttacctgttcgaccaccga
gcctccaacctgctgtggccgccatggatgggcgtcccccacggatacgagatcgagttc
gtgttcgggcagcccctgaaccccggcctcaactacacggccgaggaggaggcgctgagc
cggcgcatcatgagatactggggcaacttcgcccgcaccggggacccgaacgagccgtcg
gagcgggagcggcgctggccgtcgtacacggcggagggacagagctacgcccggctgaac
gcgcggccgctcgccgtcgcccagggcctgcgcgcacaggcctgcgccttctggacccgc
ttcctgcccaagctgctcaatgtcaccgggccgatggaggaggcggagcgccagtggcgc
ctggaattccaccgctggagctcgtacatgatgcgctggaagagccaattcgagctctac
agccgccaggagcgctgccaacccctgtag

DBGET integrated database retrieval system