KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102108729Help
Entry
102108729         CDS       T02921                                 

Definition
acetylcholinesterase-like
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    102108729
Enzymes [BR:phi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     102108729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 592 aa AA seqDB search
LLLLAPSPVATEDLLVATSAGAVRGFHVPAGPSSRVAAFLGIPYAEPPLGPLRFAPPRPA
RPWGGVLEAVAHPHACFQPVDTMFPGFGGSEMWNPNREMSEDCLYLNIWVPAPRPKAPAP
VLVWIYGGGFYSGAASLDVYDGRFLAAAEEVLVVSMNYRVGALGFLALPGHPEAPGNVGL
LDQRLALRWVQANIAAFGGDPGAVTLFGESAGAASVGLHLLSGGSRALFRRAVLQSGSPN
GPWATVGAAEGRRRAARLGRLVGCGGVGAGGAVTNETELLGCLRAAAPPQLVEHEAAVLP
QQGVFRFAFVPVVDGEFLADTPEALLGGPGRAEAEVLLGAVQDEGTYFLVYGVPGFGKDN
ESLISREEFLGGVRLGVPQANELAAEAVVLQYTDWLDQDNPVKNREALDDIVGDHNVVCP
LMHFAQRWAERGGTVFAYLFDHRASNLLWPPWMGVPHGYEIEFVFGQPLNPGLNYTAEEE
ALSRRIMRYWGNFARTGDPNEPSERERRWPSYTAEGQSYARLNARPLAVAQGLRAQACAF
WTRFLPKLLNVTGPMEEAERQWRLEFHRWSSYMMRWKSQFELYSRQERCQPL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
ctcctcctcctcgccccctcccccgtggccaccgaggacctgctggtggccacctcggcc
ggcgccgtccgcggcttccacgtgcccgccggcccctcctcgcgcgtggccgcgtttttg
gggatcccctacgccgagccccccctgggacccctgcgcttcgcccccccccgccccgcc
cggccctggggaggggtcctggaggccgtagcccacccccacgcctgcttccagccggtc
gacaccatgttcccgggcttcggcggctccgagatgtggaaccccaaccgggagatgagc
gaggattgtttgtacctcaacatttgggtgccggccccgcgccccaaggcgccggcgccg
gtgctggtgtggatttacggggggggcttctacagcggcgccgcctcgctggacgtctac
gacgggcggttcctggcggccgccgaggaggtcttggtggtctccatgaactacagggtg
ggcgccttgggcttcctggccttgccgggtcaccccgaagcccccggcaacgtggggctg
ctggaccagcggctggcgctgcgctgggtccaggccaacatcgcggccttcggcggcgac
cccggcgcggtgacgctctttggggagagcgcgggcgcggcctcggtggggctgcacctg
ctgtcggggggcagccgcgccctgttccgccgcgccgtgctgcagagcggctcgcccaac
gggccctgggccaccgtgggggcggccgagggccggcggcgagcggcgcggctgggccgc
ttggtgggctgcggcggcgtgggcgccggcggcgccgtgaccaacgagacggagctgttg
ggctgcctgcgcgccgcggcgccgccgcagctggtggagcacgaggcggccgtgctgccc
cagcaaggcgtgttccgcttcgccttcgtgcccgtggtggacggggagttcctggccgac
acccccgaggcgctgctgggcggccccggccgcgccgaggccgaggtgctgctgggcgcc
gtgcaggacgagggcacctatttcttggtgtacggcgtgccgggattcggcaaggacaac
gagagcctgatcagccgcgaggagttcctgggcggggtgaggctgggggtgccgcaggcc
aacgagctggcggccgaggccgtggtgctgcagtacacggattggctggaccaggacaac
ccggtgaagaaccgcgaggcgctggacgacatcgtgggcgaccacaacgtggtgtgcccg
ctgatgcacttcgcccagcgctgggccgagcgcggcggcaccgtcttcgcttacctgttc
gaccaccgagcctccaacctgctgtggccgccatggatgggcgtcccccacggatacgag
atcgagttcgtgttcgggcagcccctgaaccccggcctcaactacacggccgaggaggag
gcgctgagccggcgcatcatgagatactggggcaacttcgcccgcaccggggacccgaac
gagccgtcggagcgggagcggcgctggccgtcgtacacggcggagggacagagctacgcc
cggctgaacgcgcggccgctcgccgtcgcccagggcctgcgcgcacaggcctgcgccttc
tggacccgcttcctgcccaagctgctcaatgtcaccgggccgatggaggaggcggagcgc
cagtggcgcctggaattccaccgctggagctcgtacatgatgcgctggaagagccaattc
gagctctacagccgccaggagcgctgccaacccctgtag

DBGET integrated database retrieval system