KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102109451Help
Entry
102109451         CDS       T02921                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102109451 (ABHD12)
Peptidases [BR:phi01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102109451 (ABHD12)
Exosome [BR:phi04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102109451 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Thioesterase Peptidase_S9 Peptidase_S15 Abhydrolase_2 Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 102109451
NCBI-ProteinID: XP_005533064
Position
Un
AA seq 383 aa AA seqDB search
MRKRNESVTVEHERAAAVPGPLDKGCSLRRSLRLPASAAAEGMKRPLGRRYGLWFRLRKL
ILWLLGMYIAIPFLVKLCPAIQAKLVFLNFVRVPYFIDLKRPQDQGLNHTCNYYLQPEED
VTIGVWHTVPAALWKNARGKDQLWFEEALGSSHPVILYLHGNAGTRGGDHRVELYKVLSS
LGYHVVTFDYRGWGDSIGSPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNL
VRRLCERETPPDALILESPFTNIREEARSHPFSVIYRYFPGFDWFFLDPITTSGIKFAND
ENVKYISCSLLILHAEDDPVVPFHLGKKLYNIAATSRSFRDYKVQFVPFHTDLGYRHKYI
YRSPELPRILREFLGKSEHEHHH
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaacgcaacgagtcggtcacggtggagcatgaacgcgccgccgccgtgcccggg
cccctcgacaagggctgcagcctgaggcgaagcctgcgcctgcctgcctccgccgccgct
gagggcatgaagcgaccgctgggcaggcgatatggattatggtttcgattgaggaagttg
atactctggttgctgggaatgtacatagccatcccgtttctagtaaaactttgccctgct
attcaggcaaagctggtcttcctaaactttgtgagggtcccatatttcattgacttgaaa
agaccacaggatcaaggtttaaaccacacctgtaattattacttgcagccagaggaggat
gtaaccattggagtctggcacacggtccctgcagccttgtggaagaatgcccgagggaag
gaccagctgtggtttgaagaagctttgggctccagccatcctgtaatcctttacctgcac
ggcaatgcaggaacaagaggaggagatcaccgtgtggagctttacaaggttctcagctcc
ctcgggtaccacgtggtgacatttgactatcgaggctggggtgactcaataggcagcccg
tcagagaggggaatgacctatgatgcccttcatgtcttcgactggataaaagcacggagt
ggagacaaccctgtctatatatggggacactccctgggcacaggagttgcaacaaatctg
gtgcggcggctctgcgagagagaaacgcctccagatgcactgatcctggaatctccattc
accaacatacgggaggaggcacggagtcaccccttttctgtgatatacagatacttccct
ggatttgactggttcttccttgaccccatcacgacgagtggaattaaatttgcaaacgat
gagaatgtgaaatacatttcctgctccctgctcatccttcatgctgaggatgatccagtg
gtaccatttcatctgggaaaaaagctttacaacatcgcggcgacgtcgcggagtttccgg
gactacaaggtgcagtttgtgcccttccacacagacctcggctaccggcacaagtacatc
tacaggagtccagagctacctcggatactgcgggaattcctgggaaaatctgaacatgag
catcatcactga

DBGET integrated database retrieval system