KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102110155Help
Entry
102110155         CDS       T02921                                 

Gene name
ALDH1L2
Definition
aldehyde dehydrogenase 1 family, member L2
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:phi00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 922 aa AA seqDB search
MLRRAPRLLRTICTTAAAYQHKLKLALIGQSIFGQEVYNKLRKEGHKVVGVFTVPDKNGQ
ADPLALAAEKDGTPVFKFPKWRAKGKPIQEVVAAYKSVGAELNVLPFCTQFIPMDVIDCP
KHGSIIYHPSILPRHRGASAINWTLIQGDKKAGFTIFWADDGLDTGPILLQRECDVGQND
TVDDLYNRFLFPEGIKAMVEAVHLIADGKAPRIPQPKEGATYEGIQKKENAEISWDQPAA
ALHNWIRGHDKVPGAWTTINGQVVTFYGSSLLDASVPAGQELTIKGASRPGLVTKNGLVV
FGNDGKMVLVRNLQFEDGKMIPASKYFSADETTALELTEEEKKIAEDIRAIWKGILSNVA
VIEDSTDFFKSGASSMHVVRMLEEIKQKHSRLQLQNEDVYMATKFADFIQMAVRKLRGED
KEEELVIDYVSKNMNNMTVNMPYQCFINGKFINSDDGKTYDTINPADGSVIASVSSASLA
DVDKAVAAAKEAFEDGEWGRMNARERGRLMYRLADLMEEHQEELATIESIDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGATIPINQARPNHNLTFTKKEPIGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTSLKFAELSAKAGFPKGVINILPGSGGLVGQHLSE
HPDVRKVGFTGSTPTGKQIMKSAAANLKKVSLELGGKSPLIIFSDCELDRAVKMGMGAVY
FNKGENCIAAGRLFVEESIHDEFVRKVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLQ
YCETGVKEGATLVYGGRQVHRPGFFMEPTVFTDVEDHMYIAQEESFGPVMVISKFKNGDV
DGVLQRANATEYGLASGVFTKDINKALYISEKLEAGTVFINTYNKTDVAAPFGGFKLSGF
GKDLGEEALHEYLRTKAITVEY
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggagagcccctcggctgctgcggaccatctgcaccacggctgcggcttatcaa
cataagctaaagctagcccttataggccaaagtatttttggacaagaagtttataacaag
ctgagaaaagagggacataaagttgtgggtgtattcactgtgcctgacaagaatggacaa
gctgatcctttggcactggcagcagagaaggacggcactcctgtttttaagttccccaaa
tggagagctaaaggcaagcctatccaggaagttgttgcagcctacaaatctgttggagca
gagttaaatgtccttccattctgtacacagtttattcccatggatgttattgactgccca
aaacatggctctattatttaccatccatccatcctaccacgtcaccgaggagcttctgca
atcaactggactttaattcaaggagataagaaagcaggatttactattttttgggctgat
gatggtttggacactggaccaatacttctgcagcgagaatgtgatgttggccaaaatgat
accgtggatgacctatataacaggtttctcttcccagaaggaataaaggctatggtagaa
gctgtacatctaattgctgatggtaaggcccctcgtatacctcagcctaaagaaggggca
acatatgaagggatccagaaaaaggaaaatgcagagatctcctgggaccaacctgcagca
gctttgcacaattggattcgagggcatgataaagtgcctggagcatggacaacaataaat
ggacaggtggttactttttatggatcatcattacttgatgcttcagtgcctgctggacaa
gagctgacaataaaaggtgcttcaagaccaggccttgtgacaaagaatggccttgttgtt
tttggaaatgatgggaagatggtactagtgagaaatctgcagtttgaggatggaaaaatg
atccctgcatctaaatacttctctgctgatgaaacaactgccctggaacttacagaagag
gagaaaaagattgcagaagatatcagagctatttggaagggcattttaagcaatgttgct
gtgattgaggattccacagacttcttcaaatctggagcatcctctatgcatgttgtcaga
atgctagaagagatcaaacagaagcatagtagacttcagctacagaatgaagatgtgtat
atggccactaagtttgcagactttattcagatggctgtcagaaaactcagaggagaagac
aaagaggaagagttagtcattgattatgtttcaaaaaatatgaacaacatgactgtgaat
atgccataccaatgtttcataaatggcaaatttataaattctgatgatggaaaaacatat
gacactataaatccagcagatggatcagtaatagccagcgtttcttctgcctcactggct
gatgttgacaaggcagtggcagcagcaaaggaggcatttgaggatggtgaatggggaagg
atgaatgcaagggaaagagggcgactcatgtacagacttgcagacctgatggaagaacac
caagaagagttagcaacaatagagtctattgactcaggagctgtctacactttagctctg
aagactcatattggaatgtctgtgcaaacattcagatactttgctggatggtgtgacaaa
attcagggtgctacaattccaattaaccaggcccggccaaaccataatctaacattcacc
aagaaagagccaattggtgtctgtgcaattattatcccctggaattacccactgatgatg
cttgcatggaagagcgcagcatgcttggctgcaggcaacaccctcgtactcaaaccagct
caggtcacacctctgacttccttgaagtttgcggaactctcagctaaagctggatttccc
aagggtgttataaatattcttcctggttcaggtggcttagtgggacagcacctctctgaa
catccagatgttcgcaaagttggattcactggttcaacaccaactggtaaacagatcatg
aagagtgcagctgctaacctgaagaaagtttctcttgaacttggtggcaaatcaccgttg
atcatattcagtgactgtgaacttgacagagctgtaaaaatgggtatgggagcagtctat
ttcaacaaaggagaaaactgcattgcagctggcaggctgtttgtggaagaatcaattcat
gatgagtttgttagaaaagtggttgaagaaataaaaaagatgaaaattggtgacccactt
gacagatctacagatcatggtccgcaaaatcacaaggcacatttggaaaagctgctgcaa
tattgtgaaactggagtaaaagaaggagccacgctggtgtatggaggaagacaagtacat
agaccaggtttcttcatggaacccactgtgttcacagatgttgaagaccatatgtatatt
gcccaggaagaatcctttggtcctgtgatggtcatctctaaatttaaaaatggggacgtc
gatggagtattgcaacgggcaaatgccacagaatatggcttagcttcaggagttttcaca
aaagacataaacaaagctctctacatcagtgaaaaactagaagctgggacagtttttatt
aacacgtacaacaaaactgatgtggcagcaccatttggtggatttaagctgtctggcttt
gggaaagatttaggtgaagaagctcttcatgaatatctcagaaccaaagccatcactgtg
gaatattaa

DBGET integrated database retrieval system