KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102111185Help
Entry
102111185         CDS       T02921                                 

Gene name
PCSK1
Definition
proprotein convertase subtilisin/kexin type 1
Orthology
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     102111185 (PCSK1)
Peptidases [BR:phi01002]
 Serine Peptidases
  Family S8: subtilisin family
   102111185 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 749 aa AA seqDB search
MAGRRWAGRCAALAVLLAAWSLPRGGSAGRLFLNEWAAEIPAGPDAARAIADELDYDLVG
QIGSLKNHYLFRHKTHPRRSRRSAIHITKRLSDDERVSWAEQQYEKKRTKRASVRDSAES
LFNDPMWNQQWYLQDTRITPSLPKLDLHVIPVWQKGFTGKGVVITVLDDGLEWNHTDIYA
NYDPKASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNRKCGVGVAYNSRVGGIR
MLDGIVTDAIEASSIGFNPEHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGINQGRNGK
GSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATAYSSGD
YTDQRITSVDLHNECTETHTGTSASAPLAAGIFALALEANPDLTWRDMQHLVVWTSEYDP
LAGNPGWKKNGAGLMVNSRFGFGLLNANALVDLADPKRWKSVPEKRECIVKDKSFEPRLL
RANEEVIIEIPTKACEGQENSIASLEHVQLEATIEYSRRGDLHVTLVSPSGTSTVLLAER
ERDKSPNGFKNWDFMSVHTWGENPAGTWVLSITDMSRRIQNEGRIVSWKLILHGTATQPE
HMKQPRVYTSYNAVQNDRRGVEKMTDLVEDHTTLESLSEKPKATEDTSSSSDKAEDKIPS
EAMLHLLQSAFSRQMDQKQLPRKTASEKSNIPFEHFYQALKKLNKPSQLRGSEESLYSDY
VDLFYNAKPYKHRDDRLLQALVDIINEGN
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaggcgctgggccggacggtgcgcggccctggccgtactcctggcagcctgg
tccctgccccgaggaggcagcgccggaaggctcttcctcaacgagtgggcagcggagatc
ccggccggccccgacgctgccagagctattgcggacgagctggactacgacctggtgggg
cagattggatcactgaaaaaccactacttattcagacataagactcacccaagacggtcc
cgaagaagtgctattcatatcactaagagactttctgatgatgagcgggtgtcatgggca
gagcagcagtatgaaaaaaaacgaaccaagcgtgcctcagtgagagactcagcagaaagt
cttttcaacgaccccatgtggaatcagcagtggtatctgcaagatacaagaattactcct
tccctgcccaaactggatctccatgttattcctgtgtggcagaaaggatttacaggcaag
ggagttgtcatcacagtcctagatgatggactggagtggaatcacactgacatctatgct
aactatgacccaaaggcaagttatgatttcaatgacaatgatcatgatccctttcctaga
tatgacccaacaaatgaaaacaagcatgggacacggtgtgcaggagaaattgccatgcaa
gccaacaacagaaaatgtggagttggagtagcctacaactccagggttggaggtatacga
atgctggatggaatagtcaccgatgctattgaggccagttcaattggtttcaatccagaa
catgtggatatttacagtgcaagctggggccctaatgatgatggtaaaactgtggaggga
cctgggagattggcacagaaggctttcgagtatgggataaaccagggccgaaacggaaaa
ggctccatttttgtgtgggcttcagggaatggaggtcgtcagggtgacaactgtgactgt
gatggttacactgacagcatctacaccatctccattagcagtgcttctcagcaagggctt
tctccctggtatgcagagaagtgctcttcaactctggccacagcatacagcagcggggat
tatactgaccaaagaattacaagtgttgatcttcacaatgaatgtacagaaactcacacg
gggacctctgcatctgcacctctggcagcaggaatttttgctctggcgctggaagccaac
ccagatctaacgtggagggatatgcagcacttggtagtgtggacctcagaatatgatcca
ctggctggaaatccaggatggaaaaaaaatggagcaggactgatggtcaacagtcgattt
gggtttgggctactcaacgccaatgccttggtggatttagctgatcccaagagatggaaa
agtgtaccagaaaagagagagtgtattgtcaaagacaagagctttgagcccagattatta
agagcaaatgaagaagtcatcattgaaattcccacaaaagcctgcgagggtcaagagaac
tccattgcatctctggagcacgtgcagctcgaggcaacgattgaatattcccgtagaggt
gatcttcatgtcactctggtttctccatcagggaccagcactgtcttactggctgagaga
gagagagacaaatctcccaatggcttcaagaactgggacttcatgtctgtccacacttgg
ggtgaaaatccagcaggcacctgggttttaagtattactgatatgtccagacgaatacaa
aatgagggaaggattgtaagctggaaattgattttgcacggcactgctacccagcctgaa
cacatgaagcagccacgcgtgtatacatcctacaatgctgtgcagaatgacagaagagga
gtggagaagatgacagatcttgtagaggaccataccacactggagagcctgagtgaaaaa
cccaaagccacagaagacaccagcagcagcagtgacaaagcagaagataaaatcccatca
gaggccatgctgcatttactgcaaagtgcttttagcagacagatggatcagaagcaactg
ccaaggaagactgcaagcgagaagtcaaacattccattcgaacacttctatcaagccctc
aaaaaattgaacaagccctcccagttgagaggctcagaagaaagtctgtacagtgactac
gttgatcttttttacaatgccaaaccttacaagcatagagatgatagactgctgcaagca
ttggttgatatcataaatgaaggaaattaa

DBGET integrated database retrieval system